Recombinant Mouse Sphingomyelin synthase-related protein 1 (Samd8)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Sphingomyelin Synthase-Related Protein 1 (Samd8)

Recombinant Mouse Sphingomyelin Synthase-Related Protein 1, encoded by the SAMD8 gene, is a protein that has garnered significant attention due to its unique enzymatic activities and roles within cellular processes. Initially identified as a sphingomyelin synthase-related protein, it was later found to possess distinct functionalities, including ceramide phosphoethanolamine synthase activity and phosphatidylethanolamine phospholipase C (PE-PLC) activity .

Phosphatidylethanolamine Phospholipase C (PE-PLC) Activity

Recent studies have revealed that SAMD8 acts as a specific PE-PLC, capable of hydrolyzing phosphatidylethanolamine to produce diacylglycerol (DAG) without requiring ceramide as a substrate. This activity is highly specific, as SAMD8 does not exhibit phospholipase C activity towards other phospholipids like phosphatidylcholine, phosphatidylserine, or phosphatidylglycerol .

Endoplasmic Reticulum Ceramide Regulation

SAMD8 is an endoplasmic reticulum (ER)-resident protein that plays a crucial role in regulating ER ceramide levels. It helps in maintaining ceramide homeostasis, which is essential for preventing ceramide-induced apoptosis .

Expression and Localization

SAMD8 is ubiquitously expressed across various mammalian tissues, although its functional significance varies depending on the tissue type .

Mutational Studies

Mutational analysis of the SAM domain in SAMD8 has highlighted its importance in oligomer formation. Mutations in conserved residues disrupt this oligomerization, affecting the protein's distribution and function .

Table 1: Enzymatic Activities of SAMD8

Enzymatic ActivitySubstrateProduct
Ceramide Phosphoethanolamine SynthaseCeramideCeramide Phosphoethanolamine (CPE)
Phosphatidylethanolamine Phospholipase C (PE-PLC)PhosphatidylethanolamineDiacylglycerol (DAG)

Table 2: Comparison of SAMD8 with DGKδ

FeatureSAMD8DGKδ
SAM Domain FunctionOligomerization, Subcellular DistributionOligomerization, Subcellular Distribution
Enzymatic ActivityPE-PLC, CPE SynthaseDiacylglycerol Kinase

References Nature article on SMSr/SAMD8 as an ER-resident ceramide phosphoethanolamine synthase. Science.gov topic on ceramide metabolism. PMC article on macrophage characterization. PubMed article on SMSr as a mammalian PE-PLC. NCBI gene details for SAMD8. GeneCards information on SAMD8. UniProt entry for SAMD8. LOVD database for SAMD8 variants.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life can be influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will select the tag type during production. If you have a specific tag requirement, please inform us, and we will prioritize its development.
Synonyms
Samd8; Sphingomyelin synthase-related protein 1; SMSr; Ceramide phosphoethanolamine synthase; CPE synthase; Sterile alpha motif domain-containing protein 8; SAM domain-containing protein 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-478
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Samd8
Target Protein Sequence
MPAGSRAGSRLRSGSLPRPSRLTLKALRPAYAPRTPDSNGDLDTGSELGPGSPAPTAEEV EKEMAGPSQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPL EIKVLGDIKRLMLSVRKLQKIHTDVLEEMGYNSDSPMSPMTPFLSALQSADWLCNGEPTH SCDGPIPDLSSDQYQYMNGKNKHSARRLDPEYWKTILSCVYVFIVFGFTSFIMVIVHERV PDMQTYPPLPDIFLDSVPRIPWAFSMTEVCGVILCYIWILVLLLHKHRSILLRRLCSLMG TVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLRRAFAIWSGFGMTLTGVHTCGDYM FSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITT RLFLYYHTLANTRAYHQSRRARIWFPMFSFFECNVNGTVPNEYCWPFSKPAIMKRLIG
Uniprot No.

Target Background

Function
Sphingomyelin synthases play a crucial role in synthesizing sphingolipids by transferring a phosphatidyl head group to the primary hydroxyl of ceramide. SAMD8, an endoplasmic reticulum (ER) transferase, lacks sphingomyelin synthase activity but can convert phosphatidylethanolamine (PE) and ceramide into ceramide phosphatidylethanolamine (CPE), albeit with limited product yield. It appears to function as a ceramide sensor, regulating ceramide homeostasis within the ER, rather than a direct converter of ceramides. SAMD8 seems to be essential for maintaining the integrity of the early secretory pathway.
Gene References Into Functions
  1. A study revealed that all mouse SMS family members (SMSr, SMS1, and SMS2) possess CPE synthase activity. PMID: 25605874
Database Links
Protein Families
Sphingomyelin synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.