Recombinant Mouse Sphingosine 1-phosphate receptor 1 (S1pr1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
S1pr1; Edg1; Lpb1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1; Lysophospholipid receptor B1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1; CD antigen CD363
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MVSTSIPEVKALRSSVSDYGNYDIIVRHYNYTGKLNIGAEKDHGIKLTSVVFILICCFII LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPIM GWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIVSCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSSH PQKDDGDNPETIMSSGNVNSSS
Uniprot No.

Target Background

Function

Sphingosine 1-phosphate receptor 1 (S1PR1) is a G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P), predominantly coupled to Gi proteins. Activation triggers downstream signaling cascades involving RAC1, SRC, PTK2/FAK1, and MAP kinases, playing a crucial role in various cellular processes. Specifically, S1PR1 is implicated in cell migration through actin cytoskeleton reorganization and lamellipodia formation, a response modulated by sphingosine kinase 1 (SPHK1). Its involvement extends to:

  • Chemotaxis: Essential for normal chemotaxis toward S1P.
  • Cardiovascular Development: Critical for embryonic heart development and cardiac morphogenesis.
  • Angiogenesis: Regulates sprouting angiogenesis and vascular maturation, inhibiting excessive sprouting.
  • T-cell Egress: Necessary for mature T-cell egress from the thymus.
  • Bone Homeostasis: Influences osteoclast precursor cell migration and bone mineralization.
  • Lung Injury: Plays a role in pulmonary endothelial cell responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine and protection against ventilator-induced lung injury.
Gene References Into Functions
Published Research Supporting S1PR1 Function (Click to Expand)
    This list contains numerous PubMed IDs linking to relevant research articles detailing S1PR1's role in various biological processes. The full list is expanded below.
  1. S1P1 deletion in cardiac hemo-vascular precursor cells leads to ventricular non-compaction cardiomyopathy. PMID: 28338096
  2. apoM-S1P-S1PR1 signaling might underlie the pathogenesis of ALI and apoM could have physiological benefits to alleviate LPS-induced ALI. PMID: 29260347
  3. analysis of dynamics and spatial specificity of S1P1 activation in a mouse model PMID: 29079828
  4. our results indicate that the modulation of S1P1 expression and S1P/S1P1 interactions in NOD mouse thymocytes are part of the T-cell migratory disorder observed during the pathogenesis of type 1 diabetes. PMID: 29757216
  5. Study identifies functional antagonism of S1PR1 as a major mechanism for the protective effect of FTY720 in the cuprizone model and suggests pathogenic contributions of astrocyte S1PR1 signaling in primary demyelination and its potential as a therapeutic target for CNS inflammation. PMID: 29193293
  6. Collectively, these results suggest that S1PR1 acts as a major regulator of retinal neuron survival and restricts the retinal ganglion cell growth response induced by CNTF. PMID: 29234527
  7. Our data suggests that sphingosine-1-phosphate receptor 1 in macrophages plays an important role in protecting them against apoptosis in vitro and in atherosclerotic plaques in vivo, and delays diet induced atherosclerosis development in Ldlr deficient mice PMID: 29244772
  8. These data suggest that brain endothelial S1P1 maintain the BBB by regulating the proper localization of tight junction proteins and raise the possibility that endothelial S1P1 inhibition may be a strategy for transient BBB opening and delivery of small molecules into the CNS. PMID: 28396408
  9. Astrocytic S1PR controls astrocyte neurotoxicity and monocyte recruitment and activation. PMID: 28167760
  10. Tonic S1P1 signaling by endogenous sphingosine-1-phosphate contributes to intracellular Ca(2+) homeostasis by maintaining basal Na+/H+ exchanger-1 activity and controls simultaneously myofibril Ca(2+) sensitivity through its inhibitory effect on adenylate cyclase. PMID: 27207969
  11. these data demonstrate that chronic inflammation modulates S1P1 expression and tissue S1P levels PMID: 27049060
  12. promotes lymphangiogenesis and metastasis via NLRP3/IL-1beta in tumor-associated macrophages PMID: 28739604
  13. The study suggests that vascular leakage of albumin-sized particles in ApoM deficiency is S1P- and S1P1-dependent and this dependency exacerbates the response to inflammatory stimuli. PMID: 26956418
  14. The present results suggest that Fas/S1P1 signaling via activation of NF-kappaB in osteoclast precursor cells is a key factor in the pathogenesis of rheumatoid arthritis in the temporomandibular joint. PMID: 28687489
  15. Activation of the S1P1 receptor in cardiac mast cells confers cardio-protection during cardiac mast cell degranulation. PMID: 28500264
  16. this study shows that S1P1 downregulation mirrors the strength and persistence of the TCR stimulation, limiting egress of high affinity T cells from lymph nodes PMID: 27730626
  17. After axonal damage, S1PR1 expression was decreased in retinal neurons PMID: 27309795
  18. These results indicate a role for S1P signaling in Bordetella pertussis-mediated pathology. PMID: 27815382
  19. These results suggest that S1P signaling via S1P1 in cardiomyocytes plays a previously unknown and necessary role in heart development in mice in expansion of cardiomyocyte number and ventricular compaction. PMID: 27333774
  20. Profound depletion of S1p renders both erythrocyte and platelet pools necessary for recovery during anaphylactic shock. PMID: 27582371
  21. S1P induced chemotaxis in M1 macrophages and changed cytokine production in M2 macrophages. Phagocytosis was not affected by S1P-signalling. PMID: 28367448
  22. Data indicate that forkhead box F1 (Foxf1) deletion from endothelial cells decreases the abundance of sphingosine 1-phosphate receptor 1 (S1PR1). PMID: 27095594
  23. Study provided evidence for a role of S1P1 in regulating oligodendrocyte differentiation and developmental myelination PMID: 26662919
  24. S1P is localized in the presynaptic regions of mature neurons and is regulated by sphingosine-1-phosphate. PMID: 27098703
  25. S1P1 receptor-selective up-regulation reduces the severity of acute graft versus host disease by inhibiting macrophage recruitment. PMID: 25088224
  26. Early after VSV infection, WT and S1PR1(-/-) effector T cells localized exclusively within the lymph node paracortex. However, in contrast to WT, S1PR1(-/-) effector T cells failed to enter the sinuses. PMID: 26862175
  27. GPER and Gankyrin might be implicated in the hormonal regulation of endometriosis and be associated with the severity of endometriosis. PMID: 26193952
  28. Sphingosine-1-Phosphate Receptor-1 Selective Agonist Enhances Collateral Growth and Protects against Subsequent Stroke. PMID: 26367258
  29. the ability of ApoM(+)HDL to act as a biased agonist on S1P1 inhibits vascular inflammation, which may partially explain the cardiovascular protective functions of HDL. PMID: 26268607
  30. Autocrine action of S1P in DJ-1 knock-out mice vascular smooth muscle cells results from the up-regulation of SPT2. PMID: 25978603
  31. S1P1 had a significant effect in corneal allograft rejection inhibition. PMID: 25607596
  32. The role of sphingosine-1-phosphate in the production of immature double-negative thymocytes in experimental and chronic Chagas disease is reported. PMID: 25330249
  33. The neuronal sphingosine-1-phosphate/S1PR1/STAT3 signalling axis plays a critical role in the control of energy homeostasis. PMID: 25255053
  34. Sphingosine-1-phosphate receptor 1 (S1PR1) was found as a new target gene of miR-155 by in vitro and in vivo studies; its expression was decreased in SLE patients and Fas(lpr/lpr) mice. PMID: 25911753
  35. S1P sensitizes ICAPS through G-protein coupled S1P1 receptor activation of Galphai-PI3K-PKC-p38 signaling pathway in sensory neurons PMID: 25431213
  36. protective role for endothelial S1P1R against ischemic acute kidney injury most likely by regulating endothelial barrier integrity and endothelial HSP27 expression PMID: 24025642
  37. Findings suggest that sphingosine phosphate lyase (S1P lyase) expressed in the thymic medullary perivascular spaces keeps the tissue sphingosine 1-phosphate low around the vessels and promotes thymic egress via up-regulation of S1P receptor 1 (S1P1). PMID: 24343820
  38. A novel role for moesin in regulating clathrin-dependent S1PR1 internalization through clathrin-coated vesicles formation. PMID: 24358210
  39. Regulation of endothelial S1PR1 dynamically controls vascular integrity and maturation and thus modulates angiogenesis, tumor growth, and hematogenous metastasis. PMID: 24740542
  40. S1PR1 mRNA was ubiquitously expressed in all the tissues examined, and significant differences were seen in mRNA expression between H9N2 virus infected and control mice in detected tissues. PMID: 24073762
  41. Sphingosine-1-phosphate receptor 1 reporter mice reveal receptor activation sites in vivo PMID: 24667638
  42. Data suggest that the sphingosine-1-phosphate receptor S1P1-mTOR signaling axis as a potential therapeutic target in hepatic injury. PMID: 24567529
  43. S1PR1 expression on macrophages might, therefore, be relevant for restoring tissue homeostasis during the resolution of inflammation. PMID: 23934754
  44. Results suggest that S1P (sphingosine 1-phosphate) induces endothelium-dependent vasorelaxation mainly through S1P(1) receptor and involves PAR-2 (proteinase activated receptor-2) transactivation. PMID: 24131465
  45. key role of Sphk1, S1PR1 and S1PR3 in angiogenesis underlying the liver fibrosis process PMID: 23466305
  46. Data indicate taht regulation of KLF2 and S1P1 (S1pr1) provides a switch that dictates whether CD8(+) T cells commit to recirculating or tissue-resident memory populations. PMID: 24162775
  47. Impaired S1P1 phosphorylation enhances TH17 polarization and exacerbates autoimmune neuroinflammation. PMID: 24076635
  48. We demonstrate that restoration of cardiac plasma membrane levels of S1PR1 produces beneficial effects that counterbalance the deleterious beta1AR overstimulation in heart failure. PMID: 23969695
  49. Activation of S1P receptor signaling pathways using KRP-203 inhibits atherosclerosis in LDLR knockout mice. PMID: 23640484
  50. A brief treatment with S1PR1 modulator KRP203 significantly prolonged islet allograft survival, whereas additional intragraft delivery of Tregs induced tolerogenic effects selective to islet alloantigens. PMID: 23545505
Database Links

KEGG: mmu:13609

STRING: 10090.ENSMUSP00000050897

UniGene: Mm.982

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome. Membrane, caveola.
Tissue Specificity
Expressed in a wide variety of tissues with highest levels in brain, heart and spleen. Lower levels found in kidney, liver, lung, muscle, placenta, thymus, and uterus. Very low levels in intestine, stomach and testis. According to PubMed:9931453, expresse

Q&A

What is mouse S1PR1 and how does it function in cellular systems?

S1PR1 is a G protein-coupled receptor that primarily couples to Gi proteins. This receptor recognizes sphingosine-1-phosphate (S1P), a bioactive sphingolipid metabolite generated through the phosphorylation of sphingosine by sphingosine kinases (SPHK1 and SPHK2). S1PR1 regulates diverse cellular processes including cell growth, survival, differentiation, migration, and plays crucial roles in lymphocyte trafficking, vascular integrity, and inflammatory responses .

Unlike other S1P receptors, S1PR1 couples exclusively to Gi proteins, making it unique in the S1PR family. This exclusive coupling pattern explains why S1PR1 activation typically leads to inhibition of adenylyl cyclase, resulting in decreased cAMP production .

How does S1PR1 expression vary across mouse tissues and cell types?

S1PR1 shows differential expression across various tissues and cell types. Analysis of single-cell RNA sequencing data has revealed that S1PR1 mRNA is most abundant in hepatocytes compared to other cell types such as bone marrow monocytes and macrophages . In immune cells, S1PR1 is widely expressed across various types, including T cells, B cells, and macrophages .

Under pathological conditions such as non-alcoholic steatohepatitis (NASH), S1PR1 expression in bone marrow-derived macrophages (BMDMs) increases in response to lipotoxic stress induced by palmitate treatment, while expression in primary mouse hepatocytes remains unchanged . In whole liver tissue from mice fed a fast food diet (FFC), S1PR1 expression shows no significant change compared to control diet-fed animals .

What are the primary signaling pathways activated by S1PR1 in mice?

S1PR1 primarily activates Gi protein-mediated signaling pathways that lead to:

  • Inhibition of adenylyl cyclase, resulting in decreased cAMP production

  • Activation of phosphoinositide 3-kinase (PI3K) and subsequent Akt signaling

  • Stimulation of Rac GTPase, promoting cell migration

  • Activation of extracellular signal-regulated kinases (ERK)

These pathways collectively regulate cell survival, proliferation, migration, and cytoskeletal rearrangements . Recent studies have demonstrated that specific Gi-biased agonists like SAR247799 can selectively activate S1PR1-Gi signaling, which protects endothelial barrier integrity without affecting immune cell egress .

What are the most reliable methods to assess S1PR1 expression in mouse tissue samples?

Several complementary approaches can be used to accurately assess S1PR1 expression:

  • qRT-PCR: For mRNA expression analysis, quantitative PCR remains a reliable method. When analyzing S1PR1-5 expression in different tissues, ensure proper primer design and validation for specificity across the closely related receptor subtypes .

  • Immunohistochemistry/Immunofluorescence: For protein localization and expression. Recent studies have employed this technique to detect S1PR1 in tissue sections. Important controls include receptor knockout tissues or cells to validate antibody specificity .

  • Western blotting: For total protein expression. Key considerations include proper membrane preparation techniques since S1PR1 is a membrane protein.

  • Radioligand binding assays: [³H]CS1P1 has been used in autoradiograph studies to visualize S1PR1 expression patterns with high specificity and sensitivity .

  • Single-cell RNA sequencing: For cell-type specific expression analysis across heterogeneous tissues. This approach has revealed valuable insights into differential expression patterns of S1PR1 across various cell types .

How can researchers effectively manipulate S1PR1 expression or activity in mouse models?

Several approaches can be employed to modulate S1PR1 expression or activity:

  • Pharmacological modulators:

    • FTY720 (Fingolimod): Functional antagonist of S1PR1, 3, 4, and 5

    • Etrasimod: Selective antagonist of S1PR1, partial antagonist of S1PR4 and S1PR5

    • Amiselimod: Selective S1PR1 antagonist

    • SAR247799: Gi-biased agonist of S1PR1

  • Genetic approaches:

    • Conditional knockout models using Cre-loxP system for tissue-specific deletion

    • Inducible knockout systems (e.g., tamoxifen-inducible) for temporal control

    • CRISPR/Cas9-mediated genome editing for precise receptor modifications

  • Adenoviral or AAV-mediated gene delivery: Effective for acute manipulation of S1PR1 expression in specific tissues, as demonstrated in heart failure models where increasing S1PR1 density through gene therapy showed therapeutic potential .

  • Antisense oligonucleotides or siRNA approaches: For transient knockdown of S1PR1 expression.

When using pharmacological modulators, researchers should consider the selectivity profile of each compound against different S1PR subtypes to accurately interpret experimental outcomes .

What methods are optimal for investigating S1PR1-protein interactions?

To investigate protein-protein interactions involving S1PR1:

  • Co-immunoprecipitation: Effective for detecting native protein interactions, as demonstrated in studies investigating β1-adrenergic receptor and S1PR1 interactions .

  • Proximity ligation assay (PLA): Enables visualization of protein interactions in situ with high sensitivity.

  • FRET/BRET assays: For real-time monitoring of protein interactions in living cells.

  • Cryo-electron microscopy: Recently employed to determine the structure of the S1PR1-Gi signaling complex bound to the biased agonist SAR247799 at 3.47Å resolution, revealing the recognition mode for this biased ligand .

  • Cross-linking mass spectrometry: For identifying interaction interfaces between S1PR1 and partner proteins.

For all these methods, appropriate controls are essential, including the use of receptor mutants that disrupt potential interaction sites and competition with specific ligands that may enhance or disrupt the interactions .

How does S1PR1 modulation affect inflammatory processes in mouse models?

S1PR1 modulation has profound effects on inflammatory processes through several mechanisms:

  • Lymphocyte trafficking regulation: S1PR1 antagonists prevent lymphocyte egress from lymphoid organs, reducing immune cell infiltration into inflamed tissues .

  • Macrophage accumulation: Studies in NASH models show that S1PR1 antagonists (Etrasimod, Amiselimod) reduce inflammatory macrophage accumulation in the liver .

  • Inflammatory cell infiltration: Etrasimod reduces liver inflammatory infiltrates including T cells, B cells, and NKT cells in dietary models of murine NASH .

  • Endothelial barrier function: Gi-biased S1PR1 agonists like SAR247799 protect the integrity of the endothelial barrier without affecting immune cell egress, offering a novel approach to treating endothelial dysfunction-associated inflammatory diseases like IBD .

Experimental data from NASH models demonstrate that selective inhibition of S1PR receptors reverses adverse features of NASH, establishing a mechanistic link between S1P/S1PR signaling and immune inflammatory responses .

What role does S1PR1 play in cardiovascular pathophysiology?

S1PR1 has several important functions in cardiovascular pathophysiology:

  • Interaction with β1-adrenergic receptor (β1AR): Studies have identified a direct and GRK2-dependent interaction between β1AR and S1PR1 in cardiomyocytes. These receptors exhibit reciprocal downregulation, which significantly impacts cardiac hypertrophy, apoptosis, and remodeling .

  • Cardioprotective effects: S1PR1 signaling demonstrates cardioprotective properties, particularly during sustained catecholamine stimulation that mimics pathological conditions such as heart failure .

  • Counterbalancing β1AR overstimulation: Restoration of cardiac plasma membrane levels of S1PR1 produces beneficial effects that counterbalance the deleterious effects of β1AR overstimulation in heart failure .

  • Regulation of apoptosis: While β1AR can induce significant apoptosis in cardiomyocytes, S1PR1 does not. More importantly, the apoptotic response to isoproterenol stimulation increases when the S1PR1 receptor is blocked, further supporting the cardioprotective role of S1PR1 .

In rat models of post-ischemic heart failure, S1PR1 plasma membrane levels are significantly downregulated, suggesting that S1PR1 inactivation might contribute to heart failure progression .

What are the emerging therapeutic applications targeting S1PR1 in mouse disease models?

Several promising therapeutic applications targeting S1PR1 have emerged from mouse disease models:

  • Non-alcoholic steatohepatitis (NASH): Both Etrasimod (S1PR1,4,5 modulator) and Amiselimod (selective S1PR1 modulator) attenuate liver injury in dietary NASH models, with Etrasimod showing greater efficacy in reducing inflammatory cell infiltration .

  • Inflammatory bowel disease (IBD): Gi-biased S1PR1 agonist SAR247799 reverses pathology in mouse and organoid IBD models by protecting endothelial barrier integrity without affecting immune cell egress, potentially offering advantages over current S1PR1 modulators that increase the risk of immunosuppression .

  • Heart failure: Gene therapy to increase S1PR1 density in failing cardiomyocytes represents a novel therapeutic strategy, as S1PR1 counteracts the deleterious effects of β1AR overstimulation .

  • Multiple sclerosis: The development of radiotracers like [¹¹C]CS1P1 for S1PR1 enables evaluation of therapeutic response to S1PR1-targeting drugs in MS models .

These applications highlight the versatility of S1PR1 as a therapeutic target across multiple disease contexts, with emerging strategies focused on selective modulation of specific signaling pathways or receptor-receptor interactions .

How do receptor-specific S1PR1 modulators differ from pan-S1PR modulators in their effects?

Comparison of receptor-specific and pan-S1PR modulators reveals important differences in efficacy and side effect profiles:

ModulatorReceptor SpecificityObserved Effects in ModelsPotential Advantages
EtrasimodS1PR1, partial S1PR4/5More effective in improving NASH; reduces liver inflammatory infiltrates including T cells, B cells, and NKT cellsBroader anti-inflammatory effects through targeting multiple receptor subtypes
AmiselimodSelective S1PR1Attenuates liver injury but less effective than Etrasimod in reducing inflammatory cell infiltrationPotentially fewer off-target effects
FTY720 (Fingolimod)S1PR1, 3, 4, 5Ameliorates cardinal features of NASH; reduces ALT, inflammation, and hepatic inflammatory macrophage accumulationWell-established clinical profile
SAR247799Gi-biased S1PR1 agonistProtects endothelial barrier without affecting immune cell egress; effective in IBD modelsAvoids immunosuppression while maintaining barrier protection

The relative efficacy of Etrasimod compared to Amiselimod in NASH models suggests that modulation of multiple S1P receptors (S1PR1, 4, and 5) may provide additional therapeutic benefits compared to selective S1PR1 modulation alone. This may be particularly relevant in macrophage-mediated inflammation, as S1PR4 mRNA is most abundant in macrophages and monocytes .

What are the molecular mechanisms underlying S1PR1 and β1-adrenergic receptor cross-talk?

The interaction between S1PR1 and β1AR represents a complex cross-talk mechanism with significant physiological implications:

  • Reciprocal regulation: In HEK293 cells overexpressing both receptors, β1AR downregulation occurs after stimulation with sphingosine-1-phosphate (S1PR1 agonist), while S1PR1 downregulation is triggered by isoproterenol (β-adrenergic receptor agonist) .

  • GRK2 dependence: This cross-talk is mediated by G-protein–coupled receptor kinase-2 (GRK2), which triggers desensitization and downregulation processes for both receptors .

  • Opposing G-protein coupling: S1PR1 and β1AR couple to different G-proteins (Gi and Gs, respectively), resulting in opposing actions on adenylyl cyclase activity and cAMP production .

  • Physiological significance: This interaction has been demonstrated in mouse hearts undergoing chronic β-adrenergic receptor stimulation and in rat models of post-ischemic heart failure, suggesting its relevance in cardiac pathophysiology .

  • Therapeutic implications: The cardioprotective effects of S1PR1 can counterbalance the deleterious effects of β1AR overstimulation, suggesting that increasing S1PR1 expression could be therapeutic in heart failure .

This cross-talk mechanism expands our understanding beyond classic signaling paradigms, where simultaneous activation of these receptors would simply result in opposing actions on cAMP production .

How can structural insights inform the development of biased S1PR1 ligands?

Recent structural biology advances have provided valuable insights for developing biased S1PR1 ligands:

  • Cryo-electron microscopy structure: The structure of the S1PR1-Gi signaling complex bound to the Gi-biased agonist SAR247799 at 3.47Å resolution has revealed the specific recognition mode for this biased ligand .

  • Structure-function relationships: Understanding the structural basis of biased signaling enables rational design of ligands that selectively activate beneficial pathways while avoiding unwanted effects.

  • Therapeutic applications: Gi-biased S1PR1 agonists like SAR247799 can protect endothelial barrier integrity without affecting immune cell egress, potentially addressing a major limitation of current S1PR1 modulators that increase immunosuppression risk .

  • Target engagement evaluation: Structural insights also facilitate the development of imaging probes like [¹¹C]CS1P1 for evaluating target engagement and therapeutic response in vivo .

These structural studies represent a significant advance in our understanding of S1PR1 signaling and provide a foundation for developing next-generation therapeutics with improved efficacy and safety profiles .

What are emerging areas for S1PR1 research in mouse models?

Several promising research directions are emerging in the field:

  • Cell type-specific S1PR1 functions: Investigating how S1PR1 signaling differs between endothelial cells, immune cells, and other cell types to develop more targeted therapeutic approaches .

  • Biased signaling: Further exploration of biased S1PR1 agonists that selectively activate specific downstream pathways, building on recent success with Gi-biased agonists for endothelial barrier protection .

  • Receptor-receptor interactions: Expanding on discoveries of S1PR1 cross-talk with other receptors beyond β1AR, potentially uncovering new regulatory mechanisms and therapeutic targets .

  • S1PR1 in metabolic diseases: While S1PR1 modulators show promise in NASH models, their potential in other metabolic disorders remains to be fully explored .

  • Imaging and biomarker development: Advancing tools like [¹¹C]CS1P1 for in vivo imaging to better understand S1PR1 expression and function in various disease states .

What methodological challenges remain in studying S1PR1 in complex disease models?

Despite significant advances, several challenges persist in S1PR1 research:

  • Receptor redundancy: The presence of five S1P receptor subtypes with overlapping functions complicates the interpretation of phenotypes in genetic and pharmacological studies.

  • Cell type-specific effects: S1PR1 signaling can have different or even opposing effects in different cell types, necessitating the development of cell type-specific targeting approaches .

  • Dynamic regulation: S1PR1 undergoes complex regulatory processes including internalization, recycling, and degradation, which can be difficult to track in vivo.

  • Cross-talk mechanisms: Interactions with other signaling pathways and receptors add layers of complexity that require sophisticated experimental designs to unravel .

  • Translation to human disease: While mouse models provide valuable insights, translating findings to human diseases requires careful consideration of species differences in receptor expression, distribution, and signaling.

Addressing these challenges will require integrated approaches combining genetic, pharmacological, structural, and systems biology methods to fully elucidate S1PR1 biology in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.