Recombinant Mouse Sphingosine 1-phosphate receptor 5 (S1pr5)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Physiology

S1pr5 regulates immune and neural processes through S1P signaling:

Key Functions

  • Immune Cell Trafficking: Facilitates NK cell egress from bone marrow and lymph nodes .

  • Tissue-Resident Lymphocyte Retention: Downregulation enhances CD8+ T cell residency in peripheral tissues (e.g., skin) .

  • Blood-Brain Barrier Maintenance: Stabilizes endothelial integrity in the CNS .

Mechanistic Insights

  • S1pr5 activation triggers Gαi/o and Gα12 signaling, influencing cytoskeletal dynamics and migration .

  • Cooperates with transcription factors T-bet and ZEB2 to modulate effector T cell infiltration/egress .

Research Applications

Recombinant S1pr5 is critical for in vitro and in vivo studies:

ApplicationExperimental Use
Ligand Binding AssaysQuantify S1P affinity (pIC50 ≈ 8.5–9.6 for human homologs)
Migration StudiesAssess NK cell or T cell chemotaxis in transwell systems
Pathway AnalysisStudy Sphingolipid signaling and Neuroactive ligand-receptor interaction pathways

Associated Pathways and Disease Relevance

Recombinant S1pr5 is used to investigate pathologies linked to dysregulated S1P signaling:

Pathways

  • Sphingolipid Signaling: Modulates cell survival, apoptosis, and motility .

  • Neuroactive Ligand-Receptor Interaction: Impacts CNS development and oligodendrocyte function .

Disease Connections

  • Autoimmunity: S1pr5 deficiency exacerbates tissue-resident lymphocyte accumulation .

  • Cancer: Altered NK cell trafficking influences tumor surveillance .

Validation Data from Peer-Reviewed Studies

  • Western Blot: Detected at 50–55 kDa in mouse brain and transfected HEK293 lysates .

  • Flow Cytometry: Confirmed surface expression on CD27⁻CD11b⁺ NK cells .

  • Functional Assays: Forced S1pr5 expression reduced T cell infiltration into lymph nodes by 60% .

Challenges and Future Directions

While recombinant S1pr5 has advanced mechanistic studies, limitations persist:

  • Species-Specific Signaling: Mouse S1pr5 shares 94% extracellular homology with humans but may diverge in downstream effects .

  • Therapeutic Targeting: Selective S1pr5 modulators (e.g., agonists/antagonists) are under development for autoimmune diseases and cancer .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on your purchase method and location. Please contact your local distributor for the most up-to-date delivery information.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life of our products depends on several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
S1pr5; Edg8; Lpb4; Sphingosine 1-phosphate receptor 5; S1P receptor 5; S1P5; Endothelial differentiation G-protein-coupled receptor 8; Lysophospholipid receptor B4; Sphingosine 1-phosphate receptor Edg-8; S1P receptor Edg-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-400
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEPGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAAVCLAVCAFIVLENLAVLLV LVRHPRFHAPMFLLLGSLTLSDLLAGAAYATNILLSGPLTLRLSPALWFAREGGVFVALA ASVLSLLAIALERHLTMARRGPAPAASRARTLAMAVAAWGASLLLGLLPALGWNCLGRLE TCSTVLPLYAKAYVLFCVLAFLGILAAICALYARIYCQVRANARRLRAGPGSRRATSSSR SRHTPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARACPVLLQADPFLGLAMANS LLNPIIYTFTNRDLRHALLRLLCCGRGPCNQDSSNSLQRSPSAAGPSGGGLRRCLPPTLD RSSSPSEHLSPQQDGVDTSCSTGSPGVATANRSLVPTATD
Uniprot No.

Target Background

Function
Sphingosine 1-phosphate receptor 5 (S1pr5) is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that exerts diverse physiological effects on most cell types and tissues. S1pr5 is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins.
Activation of S1pr5 on oligodendroglial cells modulates two distinct functional pathways: process retraction and cell survival. Activation on O4-positive pre-oligodendrocytes triggers process retraction through a Rho kinase/collapsin response-mediated protein signaling pathway. The survival of mature oligodendrocytes induced by S1P activation is mediated via a pertussis toxin-sensitive, Akt-dependent pathway.
Overall, S1pr5 activation on oligodendroglial cells regulates two distinct functional pathways, influencing either process retraction or cell survival. The specific outcome depends on the developmental stage of the cell.
Gene References Into Functions
  1. Reduced frequency of patrolling monocytes in the bone marrow of knockout mice. PMID: 23519784
  2. Coordinated changes in CXCR4 and S1P5 responsiveness govern NK-cell trafficking. PMID: 21911833
  3. Findings suggest that S1P(5) may mediate the effects of S1P in regulating ERK-1/2 signaling in ES cells. PMID: 19228106
  4. The molecular identity, functional properties, and expression profile of the S1P5 (Edg-8) receptor have been characterized. PMID: 11705398
  5. The immune modulator FTY720 targets sphingosine 1-phosphate receptors. PMID: 11967257
  6. Edg8/S1P5 activation on oligodendroglial cells modulates two distinct functional pathways mediating either process retraction or cell survival and that these effects depend on the developmental stage of the cell. PMID: 15703400
  7. Sphingosine 1-phosphate receptors regulate chemokine-driven transendothelial migration of lymph node but not splenic T cells. PMID: 16116177
  8. KLF2 regulates T cell homeostasis at least partly by controlling CD62L and S1P1 expression, and therefore T cell egress from the thymus and circulation in the periphery. PMID: 17548599
  9. These findings identify S1P5 as a T-bet-induced gene that is required for natural killer cell egress from lymph nodes and bone marrow. PMID: 19808259

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in spleen and brain. In the CNS expression is restricted to oligodendrocytes.

Q&A

What is S1PR5 and how does it differ from other S1P receptors in immune cell trafficking?

S1PR5 is a G protein-coupled receptor that recognizes sphingosine-1-phosphate and regulates lymphocyte migration. Unlike S1PR1, which is uniformly expressed in naive and circulating memory T cells under KLF2 control, S1PR5 is only induced following antigen experience and is not expressed by naive CD8+ T cells . While both S1PR1 and S1PR5 are downregulated during TRM cell differentiation, they exhibit distinct expression patterns and molecular regulation. Notably, S1PR5 does not interact with CD69 (unlike S1PR1), indicating fundamental differences in how these receptors are regulated . Other S1P receptors (S1PR2, S1PR3, and S1PR4) are similarly expressed across resident and circulating T cell populations, while S1PR1 and S1PR5 are selectively downregulated in TRM cells across multiple tissues .

What is the temporal pattern of S1PR5 expression during T cell differentiation?

S1PR5 expression follows a distinct temporal pattern during T cell activation and differentiation:

  • S1PR5 is not detected in naive CD8+ T cells

  • Expression is induced in splenic effector T cells as early as 4 days post-infection (dpi)

  • Expression increases over time in circulating cells and is maintained in circulating memory T cells for at least 30 days

  • Expression diminishes upon T cell entry into peripheral tissues such as skin

  • S1PR5 expression is extinguished before the upregulation of the integrin CD103, which marks full acquisition of the TRM cell program

This temporal regulation suggests that S1PR5 downregulation is an early event in TRM precursor development and precedes the complete establishment of tissue residency.

How is S1PR5 expression transcriptionally regulated in T cells?

S1PR5 expression is primarily regulated by a transcriptional cascade involving T-bet and ZEB2:

  • T-bet indirectly regulates S1PR5 by activating expression of ZEB2

  • ZEB2 then acts as the major proponent of S1PR5 induction

  • Forced expression of ZEB2 in effector CD8+ T cells is sufficient to drive S1PR5 upregulation in vitro

  • CRISPR/Cas9-mediated ablation of ZEB2 in effector T cells substantially reduces S1PR5 transcripts despite normal expression of T-bet, KLF2, and S1PR1

This regulatory pathway differs from that of S1PR1, which is controlled by KLF2, demonstrating that despite functional similarities, these receptors are governed by distinct transcriptional programs.

How does the T-bet-ZEB2-S1PR5 axis regulate tissue residency of lymphocytes?

The T-bet-ZEB2-S1PR5 axis represents a previously underappreciated mechanism modulating tissue-resident lymphocyte generation:

  • T-bet activates expression of ZEB2, which directly induces S1PR5 expression

  • Tissue-derived TGF-β promotes downregulation of Tbx21 (encoding T-bet) and Zeb2, which ultimately reduces S1PR5 expression

  • Reduced S1PR5 expression hinders tissue traversal and egress, promoting TRM cell formation

  • Loss of S1PR5 enhances skin TRM cell formation by promoting peripheral T cell sequestration

  • This regulatory mechanism appears to be conserved across both innate and adaptive immune compartments

This axis constitutes a molecular checkpoint that balances peripheral T cell trafficking and TRM cell formation, with S1PR5 downregulation being required for efficient TRM cell differentiation.

What experimental approaches can be used to study S1PR5 function in vivo?

Several experimental approaches have proven valuable for studying S1PR5 function in vivo:

  • Retroviral overexpression systems: Using retroviral vectors (RVs) to drive S1PR5 expression in CD8+ T cells, achieving approximately four-fold increases in S1PR5 gene expression compared to physiological levels in effector cells

  • Adoptive transfer models: Transferring congenically marked, S1PR5-modified T cells into recipient mice to track their migration and differentiation across tissues

  • CRISPR/Cas9 gene editing: Ablating Zeb2 or S1PR5 in effector T cells before transfer into infected mice to study downstream effects on migration and differentiation

  • Intravascular labeling: Distinguishing cells located within blood vessels from those in tissue parenchyma to assess S1PR5's impact on vascular retention versus tissue infiltration

  • Immunofluorescence imaging: Confirming cellular localization patterns, particularly useful for visualizing redistribution of S1PR5-expressing cells between tissue compartments (e.g., spleen white pulp versus red pulp)

What are the functional consequences of forced S1PR5 expression on T cell localization and TRM formation?

Forced expression of S1PR5 dramatically alters T cell trafficking patterns and impairs TRM cell formation:

  • In secondary lymphoid organs:

    • S1PR5-expressing cells are severely underrepresented in lymph nodes

    • In the spleen, S1PR5-expressing cells redistribute from the T cell zone of the white pulp to the red pulp

    • There is increased retention in the vasculature rather than tissue parenchyma

  • In peripheral tissues:

    • Reduced numbers of S1PR5-expressing cells infiltrate the skin following inflammatory stimuli

    • Significant reductions in S1PR5-overexpressing CD69+ T cells observed in liver, salivary glands, small intestine, and skin

    • Diminished expression of TRM cell-associated molecules (CD69, CXCR6, CD103) in S1PR5-overexpressing T cells

  • Mechanism of impaired tissue localization:

    • These effects are not linked to increased cell death in tissues

    • Rather, they reflect S1PR5-mediated relocalization of cells to the vasculature and enhanced egress from tissues

How should experiments be designed to evaluate S1PR5's role in T cell trafficking?

When designing experiments to study S1PR5's role in T cell trafficking, researchers should consider:

  • Model selection: Utilize adoptive transfer models with congenically marked T cells (e.g., CD45.1+) to enable tracking of specific cell populations

  • Infection/inflammation models:

    • HSV skin infection model for studying skin TRM formation

    • LCMV-Armstrong infection for studying TRM formation across multiple tissues

    • Contact sensitizer application (e.g., DNFB) to induce T cell migration to skin

  • Cellular compartment analysis: Implement intravascular labeling techniques to distinguish cells in the vasculature from those in tissue parenchyma

  • Time course considerations: Include multiple time points in analysis (4, 8, 14, 30 days post-infection/transfer) to capture the dynamic nature of S1PR5 expression and T cell differentiation

  • Appropriate controls:

    • Use of control retroviral vectors (Ctrl-RV) when performing overexpression experiments

    • Include analysis of multiple tissues to distinguish tissue-specific versus general effects of S1PR5 manipulation

What methodological approaches are effective for manipulating S1PR5 expression in T cells?

Successful manipulation of S1PR5 expression in T cells has been achieved through:

  • Retroviral transduction:

    • Retroviral vectors can achieve approximately four-fold increases in S1PR5 expression compared to physiological levels

    • Congenically marked cells can be co-transferred with control cells to directly compare trafficking and differentiation

  • CRISPR/Cas9 gene editing:

    • Effective for ablating S1PR5 or its upstream regulators (e.g., Zeb2)

    • Can be performed in effector T cells prior to adoptive transfer

  • Transgenic T cell receptor models:

    • gBT-I transgenic CD8+ T cells (specific for HSV epitope gB 498-505) facilitate tracking of antigen-specific responses

    • P14 transgenic CD8+ T cells (specific for LCMV glycoprotein gp33-41) allow analysis of LCMV-specific responses

  • In vitro validation:

    • Forced expression of ZEB2 through retroviral transduction can drive S1PR5 upregulation in vitro

    • This approach confirms direct regulatory relationships before proceeding to in vivo studies

How should researchers interpret differences in S1PR5 expression across tissue contexts?

When interpreting S1PR5 expression patterns across different tissues, researchers should consider:

  • Tissue architecture differences:

    • The discrepancy between S1PR5 effects in spleen versus lymph nodes may be attributed to distinct tissue architecture

    • The spleen is highly vascularized compared to lymph nodes, which influences cell trafficking patterns

  • Temporal dynamics:

    • S1PR5 expression changes over time during the course of infection and memory development

    • Expression levels at day 4 post-infection differ from those at days 14 and 30

  • Relationship to other markers:

    • Correlation between S1PR5 downregulation and acquisition of tissue-residency markers (e.g., CD103)

    • S1PR5 expression is extinguished before CD103 upregulation, suggesting sequential programming events

  • Species conservation:

    • S1PR5 expression patterns are similar between mouse and human CD8+ T cells

    • Human CD103+ skin TRM cells show extinguished S1PR5, KLF2, and S1PR1 expression compared to circulating memory T cells

What are the proposed mechanisms for S1PR5-mediated regulation of T cell trafficking?

The current understanding of how S1PR5 regulates T cell trafficking involves several mechanisms:

  • Inhibition of tissue entry:

    • S1PR5 expression limits cellular homing to lymphoid organs

    • S1PR5 signals inhibit T cell entry into peripheral tissues like skin

  • Promotion of tissue exit:

    • S1PR5 promotes T cell egress from peripheral tissues

    • Loss of S1PR5 enhances TRM cell formation by promoting peripheral T cell sequestration

  • Altered tissue distribution:

    • In the spleen, S1PR5-expressing cells redistribute from the T cell zone to the red pulp

    • S1PR5 expression is associated with increased vascular retention rather than tissue parenchymal localization

  • Integration with other signals:

    • TGF-β signaling in tissues promotes coordinated downregulation of Tbx21, Zeb2, and S1PR5

    • This mechanism harmonizes multiple independent pathways controlling tissue exit and enforces TRM cell commitment

What are the unresolved questions regarding S1PR5 function in immune regulation?

Several important questions remain to be fully addressed:

  • Ligand distribution and gradients:

    • How are S1P gradients established and maintained across different tissue compartments?

    • Do local S1P concentrations influence the relative importance of S1PR5 versus S1PR1?

  • Cell type-specific functions:

    • While S1PR5 regulates both T cell and NK cell trafficking, are there cell type-specific mechanisms?

    • How does S1PR5 function in other lymphocyte populations beyond CD8+ T cells?

  • Therapeutic targeting:

    • Can selective modulation of S1PR5 be achieved without affecting other S1P receptors?

    • Would S1PR5 antagonism enhance TRM formation in vaccination contexts?

  • Integration with other migratory receptors:

    • How does S1PR5 signaling interact with chemokine receptor signaling networks?

    • What is the hierarchy of migratory signals when multiple receptors are engaged?

What technical challenges exist in studying S1PR5 function?

Researchers face several technical challenges when investigating S1PR5:

  • Antibody limitations:

    • Limited availability of high-quality antibodies for detecting S1PR5 protein expression

    • Reliance on transcript analysis rather than protein detection

  • Temporal dynamics:

    • Capturing the dynamic regulation of S1PR5 requires careful time-course experiments

    • Challenge of identifying the precise timing of downregulation in relation to other events

  • Tissue-specific effects:

    • Different tissues may exhibit distinct requirements for S1PR5 regulation

    • Need for simultaneous multi-tissue analysis to capture full spectrum of effects

  • Functional redundancy:

    • Potential compensatory mechanisms involving other S1P receptors

    • Distinguishing S1PR5-specific effects from broader S1P signaling impacts

How do S1PR5 and S1PR1 compare in their regulation and function?

While S1PR5 and S1PR1 both regulate T cell trafficking and are downregulated during TRM cell differentiation, they exhibit important differences:

FeatureS1PR1S1PR5
Expression in naive T cellsPresentAbsent
Transcriptional regulationKLF2-dependentT-bet→ZEB2 cascade
CD69 interactionInteracts with CD69Does not interact with CD69
Tissue specificityBroadly important for egressMay have tissue-specific effects
Expression kineticsConstitutive in naive and memoryInduced post-antigen experience
Conservation across lymphocytesWidely conservedRole varies by lymphocyte subset

This comparison reveals that despite functional similarities in promoting tissue egress, these receptors represent distinct regulatory nodes that are independently controlled yet coordinately downregulated during TRM cell differentiation .

What is the role of TGF-β in coordinating S1PR5 and S1PR1 downregulation?

TGF-β signaling serves as an overarching mechanism that coordinates the downregulation of both S1PR5 and S1PR1, despite their distinct transcriptional regulation:

  • TGF-β promotes downregulation of Tbx21 (encoding T-bet) and Zeb2, which ultimately reduces S1PR5 expression

  • TGF-β also inhibits KLF2 expression, which reduces S1PR1 levels

  • This coordinated downregulation enforces tissue retention and TRM cell commitment

  • Local tissue microenvironmental cues, including TGF-β, harmonize these independent pathways controlling tissue exit

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.