Recombinant Mouse Squalene monooxygenase (Sqle)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cholesterol Synthesis

Sqle is pivotal in the mevalonate pathway, converting squalene to squalene epoxide, a precursor for cholesterol and oxysterols. Key regulatory aspects include:

  • Rate-Limiting Step: Its activity determines flux through the pathway, influenced by sterol regulatory element-binding proteins (SREBPs) .

  • Feedback Regulation: Cholesterol excess triggers proteasomal degradation via the N-terminal regulatory domain (SM-N100), which senses lipid levels .

Regulation and Post-Translational Modifications

Sqle is dynamically regulated through:

Cholesterol-Mediated Degradation

  • Excess cholesterol accelerates Sqle degradation via MARCH6-mediated ubiquitination of SM-N100 .

  • Squalene Stabilization: Accumulation of squalene (or its derivatives) binds SM-N100, reducing MARCH6 interaction and ubiquitination .

Proteasomal Truncation

Under hypoxia or squalene excess, partial degradation generates a truncated form (trunSM):

Full-Length SqleTruncated Sqle (trunSM)
RegulationCholesterol-sensitive
LocalizationIntegral ER membrane
Catalytic DomainIntact
RoleRegulated flux

This mechanism ensures sustained pathway activity despite metabolic stress .

Research Applications and Experimental Uses

Recombinant Sqle is used in:

  • ELISA Assays: Detection of Sqle protein levels in biological samples .

  • Enzyme Kinetic Studies: Assessing inhibitor efficacy (e.g., NB-598) or substrate binding (squalene) .

  • Cancer Research: Investigating Sqle’s role in hepatocellular/prostate cancer, where cholesterol metabolism is dysregulated .

Squalene as a Feedforward Regulator

Squalene directly binds SM-N100, stabilizing Sqle and enhancing its metabolic capacity. This mechanism buffers against transient substrate fluctuations and hypoxia-induced stress .

Hypoxia-Induced Truncation

Low oxygen levels promote Sqle degradation to trunSM, which remains active. This ensures squalene clearance and prevents cytotoxic accumulation .

MARCH6-Dependent Degradation

Knockdown of MARCH6 reduces Sqle ubiquitination, highlighting its central role in cholesterol-mediated proteostasis .

Inhibitors and Therapeutic Implications

InhibitorMechanismApplications
NB-598Stabilizes Sqle, promotes truncationCancer research
TerbinafineBlocks squalene epoxidationAntifungal therapy

Inhibitors like terbinafine are used clinically, while NB-598 aids in studying Sqle regulation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development with the specified tag.
Synonyms
Sqle; Erg1; Squalene monooxygenase; Squalene epoxidase; SE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-572
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Sqle
Target Protein Sequence
MWTFLGIATFTYFYKKCGDVTLANKELLLCVLVFLSLGLVLSYRCRHRHGGLLGRHQSGA QFAAFSDILSALPLIGFFWAKSPESEKKEQLESKKCRKEIGLSETTLTGAATSVSTSFVT DPEVIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGELLQPGGYRVLQELGLGD TVEGLNAHHIHGYIVHDYESRSEVQIPYPLSETNQVQSGIAFHHGRFIMSLRKAAMAEPN VKFIEGVVLQLLEEDDAVIGVQYKDKETGDTKELHAPLTVVADGLFSKFRKSLISSKVSV SSHFVGFLMKDAPQFKPNFAELVLVNPSPVLIYQISSSETRVLVDIRGELPRNLREYMAE QIYPQLPEHLKESFLEASQNGRLRTMPASFLPPSSVNKRGVLILGDAYNLRHPLTGGGMT VALKDIKLWRQLLKDIPDLYDDAAIFQAKKSFFWSRKRTHSFVVNVLAQALYELFSATDD SLHQLRKACFLYFKLGGECVTGPVGLLSILSPHPLVLIRHFFSVAIYATYFCFKSEPWAT KPRALFSSGAVLYKACSILFPLIYSEMKYLVH
Uniprot No.

Target Background

Function
Squalene monooxygenase (Sqle) is an enzyme that catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene. This reaction is considered a rate-limiting step in the biosynthesis of steroids.
Gene References Into Functions
  1. Squalene epoxidase has been identified as a strong positional candidate gene for obesity, based on quantitative trait locus studies. PMID: 15598878
  2. Research demonstrates a critical dependence of a 205 bp region for sterol-dependent regulation of squalene epoxidase and reveals a potential framework for SREBP-promoter interaction. This framework includes a potent synergy with NF-Y, which could be of primary importance. PMID: 17027328
  3. Squalene epoxidase requires a redox partner, although cytochrome p450 reductase is not the only microsomal reductase that can fulfill this role. PMID: 17374357
Database Links
Protein Families
Squalene monooxygenase family
Subcellular Location
Microsome membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Peripheral membrane protein.
Tissue Specificity
Detected in liver.

Q&A

What is the functional role of squalene monooxygenase in cholesterol biosynthesis?

Squalene monooxygenase catalyzes the first oxygen-dependent step in the committed cholesterol synthesis pathway, converting squalene to monooxidosqualene . This reaction introduces an epoxide group that ultimately forms the signature C3-hydroxyl group of cholesterol. SM can also act a second time on monooxidosqualene to produce dioxidosqualene, which is the precursor of the regulatory oxysterol 24(S),25-epoxycholesterol . As a flux-controlling enzyme, SM plays a critical role in regulating cholesterol biosynthesis, especially under varying oxygen conditions.

What are the structural domains of mouse squalene monooxygenase and their functions?

Mouse squalene monooxygenase consists of two primary domains:

DomainLocationFunction
N-terminal regulatory domain (SM-N100)N-terminusSenses lipid levels in the ER membrane; regulates degradation in response to cholesterol or squalene levels
Catalytic domainC-terminusContains the active site; responsible for enzymatic activity

The N-terminal regulatory domain contains a hydrophobic re-entrant loop (residues ~15-40) that likely interacts with squalene and plays a role in regulating enzyme degradation . The catalytic domain contains aromatic residues and leucine residues that line the active site and are required for catalysis and substrate binding .

How is recombinant mouse squalene monooxygenase typically expressed and purified?

For expression and purification of recombinant mouse SQLE:

  • Expression system: HEK293 cells or E. coli systems are commonly used .

  • Vector construction: The SM gene is typically cloned into an expression vector with an appropriate tag (e.g., V5, FLAG, ELuc) to facilitate purification and detection .

  • Purification: Affinity chromatography using the introduced tag, followed by size exclusion chromatography.

  • Activity verification: Enzyme activity can be assessed through monitoring the conversion of squalene to monooxidosqualene using methods such as gas chromatography-mass spectrometry (GC-MS) .

How does hypoxia affect squalene monooxygenase activity and structure?

Hypoxia triggers a two-part mechanism affecting squalene monooxygenase:

  • Increased targeting to proteasome: Hypoxia stabilizes the E3 ubiquitin ligase MARCHF6, which increases targeting of SM to the proteasome .

  • Accumulation of squalene: Oxygen deprivation leads to accumulation of squalene (the substrate), which impedes the complete degradation of SM and liberates its truncated form (trunSM) .

This truncated form lacks a large portion of the lipid-sensing SM-N100 domain but retains the full catalytic domain, rendering it constitutively active and resistant to cholesterol-mediated degradation . This preserves SM activity and downstream pathway flux during hypoxia, creating a feedforward mechanism to accommodate fluctuating substrate levels .

What are the methods for detecting squalene binding to recombinant SM-N100 domain?

Several experimental approaches can be used to detect and characterize squalene binding to the SM-N100 domain:

  • Photoaffinity labeling: This technique allows for direct detection of protein-ligand interactions. Photoaffinity probes containing squalene or squalene analogs can be used to identify specific binding sites .

  • Site-directed mutagenesis: Mutating putative squalene-binding residues (particularly in the re-entrant loop) followed by binding assays can help identify residues critical for interaction .

  • Subcellular fractionation: This approach can be used to examine the localization and membrane association of SM and how it changes upon squalene binding .

  • Co-immunoprecipitation studies: These can assess how squalene affects the interaction between SM and other proteins, such as MARCH6 .

  • Gas chromatography-mass spectrometry: GC-MS in selective ion monitoring mode can be used to quantify squalene levels and correlate them with SM activity or truncation .

What experimental approaches can distinguish between full-length and truncated forms of recombinant squalene monooxygenase?

Researchers can distinguish between full-length SM and truncated SM (trunSM) using the following approaches:

  • Western blotting: Using antibodies against different regions of SM. An antibody against the C-terminal region will detect both full-length and truncated forms, while an antibody specific to the N-terminal region will only detect the full-length form .

  • Protein tagging strategies: Dual tagging approaches with different tags at the N- and C-termini can help distinguish the truncated form .

  • Mass spectrometry: This can be used to precisely define the truncation site and characterize the resulting protein fragment .

  • Functional assays: Measuring cholesterol resistance of enzyme activity. The truncated form is constitutively active regardless of cholesterol levels, while the full-length form is inhibited by high cholesterol .

  • Membrane association studies: Truncation converts SM from an integral to a peripheral ER membrane protein, which can be detected through subcellular fractionation and membrane extraction experiments .

How can researchers create a stable cell line expressing recombinant mouse squalene monooxygenase?

To establish a stable cell line expressing recombinant mouse SQLE:

  • Vector selection: Choose an appropriate mammalian expression vector containing a strong promoter (such as CMV) and selection marker (e.g., neomycin resistance).

  • Gene optimization: Consider codon optimization for mouse SQLE expression in your chosen cell line.

  • Transfection method:

    • Lipid-based transfection reagents such as Lipofectamine

    • Electroporation

    • Viral transduction (lentiviral or retroviral systems)

  • Selection strategy:

    • Apply appropriate selection antibiotic (e.g., G418 for neomycin resistance)

    • Perform limiting dilution or cell sorting to isolate single clones

    • Screen clones for expression levels using Western blot or activity assays

  • Validation:

    • Confirm expression by Western blot

    • Verify enzyme activity using squalene to monooxidosqualene conversion assays

    • Ensure proper subcellular localization through immunofluorescence or subcellular fractionation

  • Maintenance: Culture in medium containing a lower concentration of selection antibiotic to maintain stable expression.

What are the optimal conditions for measuring recombinant mouse squalene monooxygenase activity in vitro?

For optimal enzymatic activity measurement of recombinant mouse SQLE:

ParameterRecommended ConditionsNotes
BufferHEPES buffer (pH 7.4)Maintains physiological pH and stability
Temperature37°CPhysiological temperature for mammalian enzymes
CofactorsNADPH, FAD, oxygenEssential for catalytic activity
SubstrateSqualene (10-100 μM)Can be delivered in detergent micelles or liposomes
Detergent0.1% Tween-20 or Triton X-100Helps solubilize squalene
Assay time30-60 minutesBefore substrate depletion occurs

Activity can be measured by:

  • GC-MS analysis: Quantify the conversion of squalene to monooxidosqualene

  • Oxygen consumption: Using an oxygen electrode to measure oxygen uptake

  • NADPH oxidation: Spectrophotometric monitoring of NADPH consumption at 340 nm

When setting up the assay, consider the following controls:

  • Enzyme-free negative control

  • Heat-inactivated enzyme control

  • Positive control with a known active preparation

  • NB-598 (SM inhibitor) treatment as a specific inhibition control

How should researchers analyze squalene-induced effects on recombinant SM stability and truncation?

To analyze squalene-induced effects on SM stability and truncation:

  • Squalene delivery methods:

    • Prepare squalene in 1% Tween 20 in DMSO (100× stock solutions)

    • Predilute in culture medium (20-fold) before adding to cells

    • Final concentrations of Tween 20 and DMSO should be 0.01% and 1%, respectively

    • Include squalane (saturated analog) as a control to distinguish specific effects

  • Stability assessment:

    • Perform cycloheximide chase experiments to assess protein half-life

    • Compare stability of full-length SM and truncated SM under various squalene concentrations

    • Use inhibitors (e.g., MG132) to confirm proteasome involvement

  • Truncation analysis:

    • Western blot analysis using antibodies against different regions

    • Compare truncation levels in normoxia vs. hypoxia conditions

    • Quantify the ratio of truncated to full-length SM

  • MARCH6 interaction studies:

    • Co-immunoprecipitation to assess SM-MARCH6 interaction under varying squalene levels

    • Compare the proportion of SM that co-precipitates with MARCH6

  • Ubiquitination analysis:

    • Pull down SM with appropriate antibodies or tags

    • Immunoblot for ubiquitin to detect ubiquitination levels

    • Compare ubiquitination patterns with and without squalene supplementation

  • Data analysis:

    • Normalize protein levels to appropriate loading controls

    • Perform at least three independent experiments

    • Use appropriate statistical tests (e.g., t-test, ANOVA) to assess significance

What are common pitfalls when working with recombinant mouse squalene monooxygenase and how can they be addressed?

ProblemPossible CauseSolution
Low expression levelsToxicity, codon bias, promoter issuesTry different expression systems, codon optimization, inducible promoters
Protein degradationInstability in expression systemAdd proteasome inhibitors, lower incubation temperature, optimize lysis buffer
Poor solubilityMembrane protein propertiesInclude appropriate detergents, consider expressing soluble domains separately
Low enzyme activityImproper folding, cofactor deficiencyEnsure adequate FAD and NADPH, optimize buffer conditions
Inconsistent truncationVariable proteasome activityStandardize cell culture conditions, use proteasome inhibitors as controls
Substrate delivery issuesSqualene insolubilityUse proper vehicle for squalene delivery, ensure consistent emulsion
MARCH6 expression variabilityCell type differencesCharacterize MARCH6 levels in your system, consider MARCH6 overexpression

When troubleshooting activity assays specifically:

  • Ensure oxygen availability during reactions

  • Validate reagent quality, especially squalene purity

  • Consider the effects of cell density and passage number on enzyme behavior

  • Perform positive controls with commercial enzyme preparations if available

How can researchers differentiate between squalene-mediated and other regulatory mechanisms affecting recombinant squalene monooxygenase?

To differentiate between squalene-mediated and other regulatory mechanisms:

  • Use squalene synthesis inhibitors: Treating cells with squalene synthase inhibitors like TAK-475 eliminates endogenous squalene production. Effects that disappear with TAK-475 but are rescued by exogenous squalene are likely squalene-dependent .

  • Employ squalene analogs: Test structurally similar compounds:

    • Squalane (saturated analog with similar biophysical properties) should not induce squalene-specific effects

    • Monooxidosqualene and dioxidosqualene can help identify structural specificity

  • Create catalytically inactive mutants: The Y195F mutation renders SM catalytically inactive but still capable of binding squalene. Using this mutant in SQLE-knockout cells prevents metabolism of added squalene, confirming direct squalene effects .

  • Domain-specific analysis: Express the SM-N100 domain separately to isolate effects on the regulatory domain from those on the catalytic domain .

  • MARCH6 manipulation: Use MARCH6 knockdown or knockout to determine if effects persist in the absence of this E3 ligase, which would suggest alternative mechanisms .

  • Oxygen dependency: Compare effects under normoxic and hypoxic conditions to distinguish oxygen-dependent from substrate-dependent regulation .

  • Cholesterol feedback analysis: Add exogenous cholesterol to determine if the observed effects are related to cholesterol-mediated feedback rather than direct squalene action .

What controls are essential when investigating hypoxia-induced truncation of recombinant mouse squalene monooxygenase?

When investigating hypoxia-induced truncation of recombinant mouse SM, the following controls are essential:

  • Oxygen level verification:

    • Use oxygen sensors or hypoxia-indicating dyes to confirm hypoxic conditions

    • Include HIF-1α stabilization as a positive control for hypoxia response

  • Squalene measurement controls:

    • Quantify squalene levels in normoxic vs. hypoxic conditions using GC-MS

    • Include internal standards (e.g., 5α-cholestane) for accurate quantification

  • Inhibitor controls:

    • MG132 or other proteasome inhibitors to confirm proteasomal involvement

    • TAK-475 (squalene synthase inhibitor) to eliminate endogenous squalene production

    • NB-598 (SM inhibitor) to induce artificial squalene accumulation

  • Domain-specific controls:

    • Express truncated SM (SM[ΔN65]-V5) to serve as a size reference

    • Test both wild-type and catalytically inactive (Y195F) mutants

  • Genetic controls:

    • SQLE-knockout cells to eliminate endogenous enzyme contributions

    • MARCH6 knockdown to assess E3 ligase dependency

  • Structural controls:

    • Mutate putative squalene-binding residues in the re-entrant loop

    • Include phenylalanine and leucine residue mutations to test binding specificity

  • Time course controls:

    • Monitor truncation at multiple time points during hypoxia exposure

    • Include reoxygenation periods to assess reversibility

These controls will help distinguish specific hypoxia-induced and squalene-mediated effects from other cellular responses, ensuring robust and reproducible results.

What are promising approaches for developing specific modulators of recombinant mouse squalene monooxygenase activity?

Several promising approaches for developing specific SM modulators include:

  • Structure-based drug design: Using the crystal structure of the SM catalytic domain to design competitive inhibitors that bind the active site or allosteric modulators that affect enzyme conformation.

  • N-terminal domain targeting: Developing compounds that specifically bind the SM-N100 regulatory domain to modulate its stability and activity. This approach could leverage the natural squalene binding site to create molecules that either enhance or prevent truncation .

  • Protein-protein interaction disruptors: Designing molecules that specifically interrupt the interaction between SM and MARCH6, potentially stabilizing the enzyme independently of squalene levels .

  • Hypoxia-responsive modulators: Creating compounds that preferentially affect SM under hypoxic conditions, targeting the oxygen-sensing machinery that influences SM truncation .

  • Genetic approaches: Developing CRISPR-based strategies to introduce specific mutations that alter SM regulation without affecting catalytic activity, such as modifications to the N-terminal regulatory domain.

  • RNA therapeutics: Designing antisense oligonucleotides or small interfering RNAs that can modulate SM expression levels or alter splicing patterns to favor specific isoforms.

  • Antibody-based therapeutics: Developing antibodies that recognize specific domains or conformations of SM to modulate its activity or stability in vivo.

These approaches could yield valuable tools for research and potential therapeutic interventions in conditions where cholesterol synthesis dysregulation plays a role.

How might research on recombinant mouse squalene monooxygenase contribute to understanding cholesterol-related diseases?

Research on recombinant mouse SM has significant implications for understanding cholesterol-related diseases:

  • Cancer biology: SM is oncogenic in various cancer types, and understanding its regulation could lead to new therapeutic approaches. The truncated, constitutively active form may contribute to unregulated cholesterol synthesis in cancer cells, supporting their increased metabolic demands .

  • Hypoxic adaptations: The ability of SM to adapt to hypoxia through truncation may be relevant to ischemic diseases, tumor microenvironments, and altitude adaptation .

  • Metabolic disorders: Dysregulation of SM could contribute to metabolic syndrome, fatty liver disease, and obesity by altering cholesterol homeostasis. Understanding the squalene-mediated feedforward mechanism might explain metabolic adaptations .

  • Neurodegenerative diseases: Cholesterol metabolism is critical for brain function, and alterations in SM activity could be relevant to conditions like Alzheimer's disease where cholesterol metabolism is implicated.

  • Cardiovascular disease: As a rate-limiting enzyme in cholesterol synthesis, SM is a potential target for modulating cholesterol levels to prevent atherosclerosis and related conditions .

  • Genetic disorders: Studying SM regulation may provide insights into rare genetic disorders of cholesterol metabolism and identify potential compensatory mechanisms.

  • Drug development: Understanding SM regulation could lead to new cholesterol-lowering drugs that target different aspects of the pathway than current statins, potentially with fewer side effects or complementary mechanisms.

The unique regulatory mechanisms of SM, particularly its feedforward activation by squalene and hypoxia-induced truncation, represent novel paradigms that may be exploited for therapeutic intervention in these various disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.