Recombinant Mouse Stannin (Snn)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cell Cycle Regulation

Studies in human umbilical vein endothelial cells (HUVECs) reveal Snn's involvement in TNF-α-mediated G1/S cell cycle arrest . Key mechanistic insights include:

  • Gene Regulation: Snn knockdown upregulates IL-4, p29, WT1/PRKC, HRas-like suppressor, and MDM4 – all modulators of cyclin D1/p53 pathways .

  • Cell Cycle Impact: Flow cytometry shows Snn siRNA increases G1 arrest by 25-40% in TNF-α-treated HUVECs compared to controls .

Table 2: Genes Differentially Expressed After Snn Knockdown

GeneFold ChangeFunction
MDM4↑3.2xp53 inhibition, cell cycle arrest
HRas-like suppressor↑2.8xRAS/MAPK pathway modulation
Interleukin-4↑4.1xImmune signaling & growth control

Experimental Applications

While recombinant mouse Snn-specific studies are sparse, its human ortholog's applications suggest potential uses:

  • TNF-α Signaling Models: Used to study endothelial growth arrest mechanisms .

  • Toxicology Research: Native Snn mediates trimethyltin toxicity in neural models , implying recombinant forms could aid mechanistic studies.

  • Structural Studies: High conservation enables cross-species protein interaction analyses .

Production and Availability

Creative BioMart lists recombinant mouse Snn produced in:

  • Expression Systems: E. coli, mammalian cells (HEK293)

  • Tags: His, GST, Avi, Fc for detection/purification

  • Species Variants: Zebrafish, chicken, and rhesus macaque also available

Research Gaps and Opportunities

  1. Mechanistic Details: No published crystal structures or binding partners specific to mouse Snn.

  2. In Vivo Models: Lack of knockout mouse studies limits translational insights.

  3. Signaling Pathways: Potential PKC-ε interactions observed in humans remain unverified in mouse systems.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specification.
Synonyms
Snn; Stannin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-88
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Snn
Target Protein Sequence
MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTANSPEVHG
Uniprot No.

Target Background

Function
Stannin plays a crucial role in the toxic effects of organotins and participates in endosomal maturation.
Database Links

KEGG: mmu:20621

UniGene: Mm.325800

Protein Families
Stannin family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is Stannin (Snn) and why is it important in research?

Stannin (Snn) is a highly conserved, 88-amino acid protein found throughout vertebrate evolution. Its significance stems from its remarkable evolutionary conservation—rat and mouse Snn amino acid sequences are 100% identical, while human Snn differs by only two amino acids at the C-terminus. Human and mouse Snn nucleotide sequences share 90% identity . This high degree of conservation suggests Snn plays a crucial role in normal cellular function, making it an important target for understanding fundamental biological processes.

What are the known biological functions of Stannin?

Current research indicates that Snn plays multiple roles in cellular processes:

  • Necessary (but not sufficient) for trimethyltin (TMT) toxicity

  • Involved in tumor necrosis factor-α (TNF-α) signaling pathways

  • Potential regulatory role in cell cycle control, particularly at the G1/S checkpoint

  • May influence cellular growth arrest mechanisms in response to inflammatory stimuli

Despite these insights, the complete functional profile of Snn remains incompletely characterized, highlighting the need for continued research in this area.

What challenges exist in studying native Stannin protein?

The primary challenge in studying native Snn protein is the lack of specific, high-affinity antisera . Without reliable Snn-specific antibodies, researchers face significant limitations in:

  • Direct protein detection and quantification

  • Immunoprecipitation studies to identify binding partners

  • Immunohistochemical analysis of tissue distribution

  • Assessment of post-translational modifications

These technical limitations necessitate alternative approaches such as gene expression analysis, siRNA-mediated knockdown, and recombinant protein expression systems to indirectly study Snn function .

How is Snn gene expression regulated?

Snn mRNA expression is induced by tumor necrosis factor-α (TNF-α) treatment in a protein kinase C-ε (PKC-ε)-dependent manner in human umbilical vein endothelial cells (HUVECs) . This regulatory pathway suggests Snn may be part of inflammatory response networks. The specific transcription factors binding to the Snn promoter have not been fully characterized based on the available research, but the PKC-ε dependency indicates involvement of downstream transcription factors in this signaling pathway.

What experimental models are most suitable for studying Snn function?

Based on current research, human umbilical vein endothelial cells (HUVECs) provide an effective model system for studying Snn function, particularly in the context of TNF-α signaling . These cells demonstrate:

  • Measurable baseline Snn expression

  • Responsiveness to TNF-α stimulation with altered Snn expression

  • Compatibility with siRNA-mediated knockdown approaches

  • Measurable phenotypic changes (cell growth inhibition, cell cycle alterations) when Snn expression is modulated

For mechanistic studies, the HUVEC model allows examination of Snn's role in inflammatory signaling and cell cycle regulation in a physiologically relevant vascular cell type.

How does Snn knockdown affect TNF-α-mediated cellular processes?

Microarray analysis has revealed that Snn knockdown in TNF-α-treated HUVECs results in differential expression of 96 genes compared to TNF-α treatment alone . Key findings include:

  • Upregulation of several genes associated with cell growth and cell cycle control, including:

    • Interleukin-4

    • p29

    • WT1/PRKC

    • HRas-like suppressor

    • MDM4

  • These genes act upon cyclin D1 and/or p53, key regulators of the G1 phase of the cell cycle

  • Flow cytometry analysis shows significantly increased G1 cell cycle arrest in HUVECs with Snn knockdown in response to TNF-α treatment

  • Snn knockdown further inhibits cell growth beyond that observed with TNF-α alone, suggesting a regulatory role in cell cycle progression

These findings point to Snn's involvement in modulating TNF-α-induced cell cycle arrest, potentially as a negative regulator of G1/S checkpoint activation.

What methodological approaches are most effective for Snn knockdown studies?

For effective Snn knockdown in experimental systems, validated siRNA approaches have shown success. The procedure outlined in current research involves:

  • Construction of Snn siRNA following established protocols:

    • Designing sense and antisense DNA oligonucleotides containing sequences complementary to the T7 promoter

    • Separate hybridization to a T7 promoter and conversion to double-stranded form with Exo-Klenow DNA polymerase

    • Mixing each reaction with T7 RNA polymerase to generate siRNA templates

    • Combining sense and antisense reactions to form dsRNA

    • Purification and elution into nuclease-free water

  • Validation of knockdown efficiency:

    • RT-PCR analysis of Snn mRNA levels

    • Functional assays to confirm altered cellular responses

This approach has been validated for effective Snn knockdown in HUVECs and could be adapted for other cell types of interest .

How can microarray data be effectively analyzed to elucidate Snn function?

Based on successful research approaches, effective analysis of microarray data to understand Snn function should include:

  • Experimental design:

    • Comparison between TNF-α-stimulated cells with and without Snn knockdown

    • Appropriate biological replicates and controls

  • Data processing:

    • Quality control of raw data

    • Normalization and statistical analysis to identify differentially expressed genes

  • Functional interpretation:

    • Focus on pathways related to cell cycle regulation, particularly genes affecting the G1/S checkpoint

    • Analysis of genes regulating cyclin D1 and p53 pathways

    • Integration with cellular phenotype data (growth inhibition, cell cycle arrest)

  • Validation:

    • Confirmation of key gene expression changes through RT-qPCR

    • Functional studies to verify the biological significance of identified pathways

This comprehensive approach facilitated the identification of 96 differentially expressed genes in previous research, revealing Snn's potential role in cell cycle regulation .

What are the optimal approaches for studying Snn's role in cell cycle regulation?

To effectively investigate Snn's role in cell cycle regulation, researchers should consider:

  • Cell synchronization methods:

    • Serum starvation/reintroduction

    • Chemical synchronization (e.g., thymidine block)

    • Contact inhibition/release

  • Cell cycle analysis techniques:

    • Flow cytometry with propidium iodide staining

    • BrdU incorporation assays

    • Expression analysis of cell cycle markers

  • Targeted interventions:

    • siRNA-mediated Snn knockdown

    • Overexpression of recombinant Snn

    • Combinatorial approaches with cell cycle inhibitors

  • Mechanistic investigations:

    • Analysis of cyclin D1 and p53 pathway components

    • Assessment of CDK inhibitor expression

    • Phosphorylation status of retinoblastoma protein

Previous research using flow cytometry demonstrated significantly increased G1 cell cycle arrest in HUVECs with Snn knockdown in response to TNF-α treatment, suggesting these approaches can yield valuable insights into Snn's regulatory functions .

How should researchers interpret the relationship between Snn and trimethyltin (TMT) toxicity?

When investigating Snn's role in TMT toxicity, researchers should consider:

  • Mechanistic relationship:

    • Snn has been demonstrated to be necessary but not sufficient for TMT toxicity

    • This suggests Snn functions as a mediator or facilitator rather than a direct effector

  • Experimental approach:

    • Dose-dependent studies with varying TMT concentrations

    • Time-course analyses to determine temporal relationships

    • Combination of knockdown and overexpression studies

  • Pathway analysis:

    • Investigation of potential overlap between TNF-α signaling and TMT toxicity pathways

    • Focus on cell death mechanisms (apoptosis, necrosis)

    • Consideration of oxidative stress responses

  • Cell-type specificity:

    • Comparison of TMT responses across cell types with varying Snn expression levels

    • Investigation of tissue-specific vulnerability to TMT

This multi-faceted approach can help clarify whether Snn's roles in TNF-α signaling and TMT toxicity involve shared or distinct molecular mechanisms.

What considerations are important when designing recombinant mouse Snn proteins for functional studies?

When designing recombinant mouse Snn proteins for functional studies, researchers should address:

  • Expression system selection:

    • Bacterial systems may be suitable for this small protein

    • Mammalian expression systems if post-translational modifications are critical

  • Fusion tag considerations:

    • N-terminal vs. C-terminal tag placement

    • Cleavable vs. permanent tags

    • Tag impact on protein folding and function

  • Purification strategy:

    • Affinity chromatography based on selected tags

    • Secondary purification steps for higher purity

    • Endotoxin removal for cell-based functional studies

  • Quality control:

    • Verification of protein folding

    • Assessment of aggregation state

    • Functional validation in cellular assays

  • Storage conditions:

    • Buffer optimization for stability

    • Lyophilization vs. solution storage

    • Freeze-thaw cycle limitations

Given the challenges in studying native Snn due to lack of specific antibodies , well-designed recombinant proteins could provide valuable tools for generating antibodies and conducting structure-function studies.

What are promising approaches for elucidating the structure-function relationship of Snn?

Given Snn's high evolutionary conservation and apparent importance in cellular processes, key approaches for structure-function studies include:

  • Structural biology techniques:

    • X-ray crystallography of recombinant Snn

    • NMR studies to assess dynamic properties

    • Computational modeling based on sequence homology

  • Mutagenesis studies:

    • Targeted mutations of conserved residues

    • Creation of human-mouse chimeric proteins to investigate species-specific differences

    • Domain deletion/swapping experiments

  • Interaction studies:

    • Yeast two-hybrid screening for binding partners

    • Pull-down assays with recombinant Snn

    • Proximity labeling approaches (BioID, APEX)

  • Functional validation:

    • Rescue experiments with mutant Snn constructs in knockdown cells

    • Structure-guided inhibitor development

    • In vivo models with modified Snn

These approaches could help connect Snn's molecular structure to its roles in TNF-α signaling and cell cycle regulation identified in current research .

How should researchers integrate Snn studies with broader investigation of inflammatory signaling networks?

To effectively position Snn research within the broader context of inflammatory signaling:

  • Systems biology approaches:

    • Integration of Snn-related transcriptomic data with existing inflammatory network models

    • Multi-omics studies combining transcriptomics, proteomics, and metabolomics

    • Mathematical modeling of TNF-α signaling networks with and without Snn

  • Pathway crosstalk analysis:

    • Investigation of interactions between Snn-dependent pathways and other inflammatory cascades

    • Examination of how Snn influences NF-κB signaling

    • Assessment of Snn's impact on cytokine production networks

  • Physiological context:

    • Studies in primary cells from different tissues

    • Investigation in disease models with inflammatory components

    • Examination of how Snn influences resolution of inflammation

  • Therapeutic relevance:

    • Assessment of how Snn expression/function correlates with inflammatory disease severity

    • Exploration of Snn as a potential biomarker or therapeutic target

Current research establishing Snn's involvement in TNF-α responses in HUVECs provides a foundation for these broader investigations into inflammatory signaling networks .

How can researchers overcome the challenge of limited Snn-specific antibodies?

The lack of specific, high-affinity antisera against Snn presents a significant challenge . Researchers can address this through:

  • Custom antibody development:

    • Use of highly purified recombinant Snn as immunogen

    • Epitope mapping to identify unique Snn regions

    • Validation across multiple techniques (Western blot, immunoprecipitation, immunofluorescence)

  • Epitope tagging strategies:

    • Generation of cell lines expressing tagged Snn constructs

    • Use of well-characterized tag antibodies (FLAG, HA, V5)

    • Validation to ensure tag doesn't disrupt protein function

  • Alternative detection methods:

    • MS-based proteomics approaches

    • RNA-based surrogate measurements (RT-qPCR, RNA-FISH)

    • Proximity ligation assays with antibodies to interacting partners

  • Genetic engineering approaches:

    • CRISPR-Cas9 knock-in of tags at endogenous loci

    • Reporter gene fusions for visualization and quantification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.