Recombinant Mouse StAR-related lipid transfer protein 3 (Stard3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our standard shipping method includes blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Stard3; Es64; Mln64; StAR-related lipid transfer protein 3; Protein ES 64; Protein MLN 64; START domain-containing protein 3; StARD3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSKRPGDLACDLERSLPALASLGTSLSHSQSLSSHFIPPPLEKRRAISDVRRTFCLFVTF DLLFISLLWIIELNTNTGIRKNLEQEVIHYSFQSSFFDIFVLAFFRFSGLLLGYAVLRLQ HWWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAE EERWYLAAQAAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVTGKKSFSAQEREYI RQGKEATAVVDQILAQEENWKFERSNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQE VILQPERMVLWNKTVTACQILQRVEDNTLVSYDVSSGAAGGVVSPRDFVNVRRIERRRDR YLSSGIATTHCSKPPTHKYVRGENGPGGFIVLKSANNPRVCTFVWILNTDLKGRLPRYLI HQSLGATMFEFAFHLRQRVGELGARA
Uniprot No.

Target Background

Function
StAR-related lipid transfer domain 3 (Stard3/MLN64) is a sterol-binding protein that facilitates cholesterol transport from the endoplasmic reticulum to endosomes. It establishes a contact site between the endoplasmic reticulum and late endosomes by localizing to late endosome membranes and interacting with VAPA and VAPB. Stard3 acts as a lipid transfer protein, redirecting sterol to the endosome at the expense of the cell membrane and promoting membrane formation within endosomes. While Stard3 may also mediate cholesterol transport between other membranes, such as the mitochondria membrane or cell membrane, further experimental evidence is needed. Primarily, Stard3 mediates cholesterol transport from the endoplasmic reticulum to endosomes. Notably, it does not activate transcriptional cholesterol sensing.
Gene References Into Functions
  1. The role of endosomal cholesterol trafficking protein, StAR-related lipid transfer domain 3 (StarD3/MLN64), in BRIN-BD11 insulinoma cells. PMID: 27679500
  2. A transport pathway for endosomal cholesterol to mitochondria that requires MLN64, but not NPC1 PMID: 19965586
  3. Mice homozygous for the Mln64 mutant were viable, neurologically intact, and fertile. No significant changes in plasma lipids, liver lipids, or expression of genes involved in sterol metabolism were observed, except for an increase in sterol ester storage PMID: 14963026
  4. Hepatic MLN64 over-expression induced damage and apoptosis in murine livers and altered cholesterol metabolism. PMID: 17589922
Database Links
Protein Families
STARD3 family
Subcellular Location
Late endosome membrane; Multi-pass membrane protein.

Q&A

What is the primary function of mouse Stard3 in cellular lipid homeostasis?

Stard3 (also known as MLN64 in humans) functions primarily as a cholesterol transport protein that creates and maintains membrane contact sites between the endoplasmic reticulum (ER) and late endosomes. At these contact sites, Stard3 facilitates the directional movement of cholesterol from the ER to endosomal compartments . This protein contains a C-terminal steroidogenic acute regulatory (START) domain responsible for binding and transferring cholesterol, and an N-terminal metastatic lymph node 64 domain that anchors it to late endosomal membranes .

How does the domain structure of mouse Stard3 relate to its function?

Mouse Stard3 contains several functionally distinct domains that work in concert to enable its cholesterol transport activity:

DomainPositionFunction
MENTAL (MLN64 N-Terminal) domainN-terminalAnchors protein to late endosomal membranes
FFAT motifCentral regionInteracts with VAP proteins in the ER; contains phosphorylation sites (e.g., S209, S213)
START domainC-terminalBinds and transfers cholesterol molecules

The MENTAL domain is crucial for targeting Stard3 to late endosomes. The central region contains a FFAT (two phenylalanines in an acidic tract) motif that binds to VAP-A and VAP-B proteins in the ER membrane, creating an organelle tethering complex . This interaction is regulated by phosphorylation events on serine residues in and around the FFAT motif . The START domain forms a hydrophobic pocket that can accommodate one cholesterol molecule for transport .

The functional interdependence of these domains is essential for Stard3's role as both a structural tether and active lipid transporter. Mutations that disrupt any of these domains (such as the M307R/N311D mutations in the START domain) can compromise cholesterol binding and transport capabilities .

What experimental evidence supports Stard3's role in sterol transport?

Multiple experimental approaches have confirmed Stard3's cholesterol transport function:

  • Fluorescent sterol probes: Using the D4 fragment of perfringolysin O (GFP-D4) and filipin, researchers have shown that Stard3 overexpression leads to cholesterol accumulation in late endosomes .

  • Ultrastructural analysis: Electron microscopy has revealed that Stard3 expression increases the formation of intraluminal vesicles (ILVs) and multilamellar structures in endosomes, which are dependent on cholesterol availability .

  • Biochemical assays: In vitro reconstitution experiments have demonstrated direct sterol transfer activity of the Stard3 START domain .

  • Genetic approaches: Studies using Stard3 mutants deficient in sterol binding (Stard3 ΔSTART and Stard3 M307R/N311D) show abolished cholesterol transport activity while maintaining membrane tethering capabilities .

  • Contact site disruption: VAP protein silencing experiments have confirmed that Stard3-mediated ER-endosome contacts are essential for efficient cholesterol transport and subsequent endosomal membrane remodeling .

What are the recommended approaches for studying Stard3-mediated membrane contact sites?

When investigating Stard3-mediated membrane contact sites, researchers should consider the following methodological approaches:

  • Fluorescence microscopy: Co-localization studies using fluorescently tagged Stard3 and organelle markers (such as Lamp1 for late endosomes and ER-specific markers) can visualize contact sites. Super-resolution microscopy techniques provide enhanced spatial resolution of these nanoscale contacts .

  • Proximity ligation assays: This approach can detect protein-protein interactions between Stard3 and VAP proteins at contact sites with high sensitivity and specificity .

  • Electron microscopy: Transmission electron microscopy allows direct visualization of membrane contact sites at nanometer resolution. Immunogold labeling can confirm the presence of Stard3 at these junctions .

  • Contact site quantification: Measure both the number and extent of ER-endosome contacts in control versus Stard3-expressing cells. Software-based quantification of membrane proximity from electron micrographs provides objective measurement .

  • Functional disruption: Employ specific mutations in the FFAT motif of Stard3 or deplete VAP proteins to disrupt contact sites and assess functional consequences. Phosphomimetic mutations (e.g., S209E) can be used to study the effect of constitutive phosphorylation on contact site formation .

When implementing these approaches, it is crucial to include appropriate controls, such as Stard3 mutants that retain membrane targeting but lack cholesterol binding ability, to distinguish between structural and functional aspects of contact sites.

How can researchers effectively measure Stard3-mediated cholesterol transport activity?

Quantifying Stard3-mediated cholesterol transport requires multilevel analysis using complementary approaches:

  • Fluorescent sterol probes visualization:

    • Use GFP-D4 (perfringolysin O fragment) for live-cell imaging of accessible cholesterol

    • Apply filipin staining for fixed-cell analysis of free cholesterol distribution

    • Establish optimal probe concentration and incubation conditions to minimize artifacts

  • Subcellular fractionation and lipid quantification:

    • Isolate endosomal fractions using gradient centrifugation

    • Quantify cholesterol content using enzymatic assays or mass spectrometry

    • Compare cholesterol levels in different cellular compartments to assess redistribution

  • Ultrastructural analysis:

    • Employ stereology on electron micrographs to quantify internal membrane content of endosomes

    • Measure multilamellar and multivesicular structures as indicators of cholesterol-dependent membrane formation

    • Compare wild-type Stard3 effects with sterol-binding deficient mutants

  • In vitro transport assays:

    • Use purified recombinant Stard3 START domain

    • Measure fluorescent sterol transfer between donor and acceptor liposomes

    • Monitor transfer kinetics under varying conditions (pH, temperature, lipid composition)

  • Cellular cholesterol distribution:

    • Develop flow cytometry protocols using fluorescent sterol probes

    • Quantify plasma membrane versus intracellular cholesterol pools

    • Establish time-course experiments to track cholesterol movement following Stard3 expression

For rigorous assessment, researchers should combine multiple approaches and include appropriate controls, such as sterol-binding deficient Stard3 mutants (M307R/N311D) and contact site disruption models (VAP-silenced cells).

What controls are essential when analyzing Stard3 phosphorylation and its effects on function?

When investigating Stard3 phosphorylation, particularly around the FFAT motif, the following controls are essential:

  • Phosphorylation state controls:

    • Non-phosphorylatable mutants (e.g., S209A, S213A) to mimic constitutively dephosphorylated states

    • Phosphomimetic mutants (e.g., S209E, S213E) to mimic constitutively phosphorylated states

    • Double and triple mutants to assess combinatorial effects of multiple phosphorylation sites

  • Binding affinity controls:

    • In vitro binding assays using synthetic peptides with defined phosphorylation states

    • Measurement of dissociation constants (KD) between Stard3 FFAT peptides and VAP-MSP domains

    • Comparison between wild-type and mutant peptides with varying phosphorylation configurations

  • Cellular localization controls:

    • Immunofluorescence to confirm proper endosomal localization of phospho-mutants

    • Co-localization analysis with ER and endosomal markers

    • Quantification of contact site formation with different phospho-variants

  • Functional outcome controls:

    • Assessment of cholesterol transport efficiency with phospho-variants

    • Measurement of endosomal cholesterol content and internal membrane formation

    • Comparison with VAP-binding deficient mutants

Research has shown that phosphorylation of serine residues in and around the Stard3 FFAT motif (S209, S213, S217) modulates its interaction with VAP proteins. For example, phosphorylation at S209 influences the binding affinity to VAP-A and VAP-B, with dissociation constants (KD) of 5.6 ± 0.3 and 7.1 ± 0.3 μM respectively, affecting the efficiency of ER-endosome contact formation .

How can researchers distinguish between Stard3's structural and functional roles at membrane contact sites?

Differentiating between Stard3's structural role (membrane tethering) and functional role (cholesterol transport) requires sophisticated experimental design:

  • Mutant comparison strategy:

    • Utilize Stard3 ΔSTART mutants that maintain membrane targeting and tethering but lack cholesterol transport ability

    • Compare with full-length Stard3 to isolate effects specifically due to cholesterol transport

    • Include the Stard3 M307R/N311D double mutant that specifically disrupts the cholesterol-binding pocket while preserving protein structure

  • Contact site quantification coupled with functional assessment:

    • Measure the extent of ER-endosome contacts using electron microscopy

    • Simultaneously assess cholesterol transport using sterol probes

    • Correlate contact site abundance with transport efficiency under various conditions

  • Organelle-specific cholesterol sensors:

    • Deploy fluorescent cholesterol sensors targeted to specific organelles

    • Monitor real-time cholesterol flux at contact sites

    • Compare contact site abundance with local cholesterol concentration changes

  • Acute protein inactivation approaches:

    • Implement optogenetic or chemical-genetic tools to acutely disrupt either the tethering or transport function

    • Assess immediate versus delayed effects to distinguish direct from consequential outcomes

    • Use FRAP (Fluorescence Recovery After Photobleaching) to measure dynamic protein exchange at contact sites

Research has demonstrated that Stard3-mediated cholesterol transport depends on both sterol-binding capacity and the ability to form membrane contacts. When VAP proteins are silenced, disrupting ER-endosome contacts, Stard3-expressing cells show significantly reduced internal membrane formation in endosomes despite the presence of functional Stard3 protein, highlighting the interdependence of these roles .

What methodologies can elucidate the molecular mechanisms of Stard3-VAP interaction at contact sites?

To investigate the molecular details of Stard3-VAP interactions at membrane contact sites, researchers should consider:

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM of Stard3-VAP complexes

    • NMR spectroscopy to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify regions of conformational change upon binding

  • Interaction kinetics analysis:

    • Surface plasmon resonance (SPR) to measure association/dissociation rates

    • Microscale thermophoresis to determine binding affinities under various conditions

    • FRET-based assays to monitor interactions in living cells

  • Phosphorylation state analysis:

    • Quantitative phosphoproteomics to identify regulated phosphorylation sites

    • In vitro kinase assays to identify kinases responsible for FFAT motif phosphorylation

    • Site-specific phospho-antibodies to track phosphorylation status in different cellular contexts

  • Single-molecule techniques:

    • Single-molecule FRET to observe conformational changes during binding

    • Single-particle tracking to monitor the dynamics of individual Stard3-VAP complexes

    • Super-resolution microscopy to visualize nanoscale organization at contact sites

Recent biochemical studies have shown that phosphorylation at S209 and S213 in the FFAT motif region of Stard3 modulates its interaction with the MSP domains of VAP proteins. The binding affinity is differentially affected by phosphorylation state, with phosphorylation at certain positions increasing affinity. For example, phosphorylation at S209 enables interaction with VAP-A and VAP-B with dissociation constants in the micromolar range (5.6 ± 0.3 and 7.1 ± 0.3 μM, respectively) .

How can researchers investigate the role of Stard3 in pathological conditions?

To study Stard3's role in pathological states, particularly in cancer models where it may be co-amplified with HER2:

  • Clinical correlation studies:

    • Analyze Stard3 expression in tissue microarrays

    • Correlate expression with pathological complete response (pCR) in treatment scenarios

    • Assess prognostic value through multivariate analysis with established markers

  • Mechanistic investigations in disease models:

    • Create cell lines with Stard3 overexpression or knockout in relevant genetic backgrounds

    • Analyze effects on cholesterol distribution and cellular signaling pathways

    • Assess changes in endosomal morphology and function in pathological versus normal states

  • Therapeutic targeting approaches:

    • Develop small molecule inhibitors of the Stard3 START domain

    • Design peptide inhibitors of the Stard3-VAP interaction

    • Test effects of disrupting Stard3 function on cancer cell viability and response to therapy

  • In vivo disease modeling:

    • Generate conditional Stard3 knockout or overexpression mouse models

    • Cross with disease-specific models (e.g., MMTV-Neu for breast cancer)

    • Assess impact on disease progression and response to therapy

A recent clinical study investigated Stard3 as a predictive biomarker in HER2-positive breast cancer, examining its correlation with pathological complete response following neoadjuvant systemic therapy. The study employed multivariate analysis with binomial logistic regression to evaluate Stard3's predictive value alongside established clinical parameters .

What are common challenges in analyzing Stard3-mediated changes in cellular cholesterol distribution?

Researchers frequently encounter several challenges when analyzing Stard3's effects on cholesterol distribution:

  • Probe specificity limitations:

    • GFP-D4 and filipin have different detection thresholds and specificities

    • Filipin can detect total free cholesterol, while GFP-D4 binds specifically to accessible cholesterol pools

    • Optimization of fixation and staining protocols is crucial to minimize artifacts

    • Always validate observations with complementary detection methods

  • Compartment identification issues:

    • Overlapping signals from adjacent organelles can complicate interpretation

    • Co-localization analysis requires careful selection of organelle markers

    • 3D reconstruction may be necessary to distinguish true co-localization from superimposition

    • Super-resolution microscopy provides improved spatial discrimination

  • Quantification challenges:

    • Establishing appropriate thresholds for positive signals

    • Normalizing cholesterol signals across different cellular regions

    • Accounting for cell-to-cell variability in expression levels

    • Developing automated, unbiased analysis workflows

  • Temporal considerations:

    • Acute versus chronic effects of Stard3 expression

    • Compensatory mechanisms that may emerge over time

    • Kinetic analysis of cholesterol redistribution following Stard3 induction

For robust analysis, researchers should employ standardized image acquisition parameters, include appropriate controls (Stard3 mutants), and use complementary approaches such as biochemical fractionation alongside imaging. Statistical analysis should account for cell-to-cell variability, with sufficient sample sizes to detect biologically meaningful differences .

How should researchers interpret contradictory findings in Stard3 functional studies?

When confronted with contradictory findings regarding Stard3 function, consider the following analytical approaches:

  • Methodological differences assessment:

    • Evaluate disparities in experimental systems (cell types, expression levels, etc.)

    • Compare detection methods and their limitations

    • Assess temporal dimensions of experiments (acute vs. chronic effects)

  • Context-dependent function analysis:

    • Consider cell type-specific factors that may influence Stard3 function

    • Examine the expression of interaction partners (VAPs, STARD3NL)

    • Analyze baseline cholesterol levels and distribution

  • Compartment-specific effects reconciliation:

    • Examine whether contradictions reflect organelle-specific differences

    • Consider that Stard3 may have different effects on various cholesterol pools

    • Analyze whether membrane contact site abundance correlates with functional outcomes

  • Integrated data analysis framework:

    • Develop mathematical models incorporating multiple cholesterol pools

    • Use systems biology approaches to predict compensatory mechanisms

    • Perform meta-analysis of multiple studies to identify consistent patterns

For example, while some studies suggest that Stard3 may transport cholesterol to mitochondria under certain conditions (similar to StAR/StarD1), more recent evidence indicates its primary role is in ER-to-endosome transport. These apparently contradictory findings may reflect context-dependent functions, with the dominant pathway determined by cellular conditions and the presence of specific interaction partners .

What statistical approaches are recommended for analyzing Stard3-mediated effects?

For robust statistical analysis of Stard3-mediated effects on cellular cholesterol homeostasis:

  • Appropriate statistical tests selection:

    • For comparing cholesterol distribution between two groups: two-sided Wilcoxon tests for non-parametric data or t-tests for normally distributed data

    • For multiple experimental conditions: ANOVA with appropriate post-hoc tests (Tukey, Bonferroni)

    • For correlation analysis between Stard3 expression and cellular parameters: Pearson correlation for linear relationships

  • Advanced statistical modeling:

    • For predicting categorical outcomes (e.g., treatment response): binomial logistic regression

    • For survival analysis: Kaplan-Meier method and log-rank test, with Cox Proportional Hazard models for multivariate analysis

    • For analyzing complex relationships: generalized linear models with appropriate link functions

  • Sample size and power considerations:

    • Perform power analysis to determine adequate sample sizes

    • Account for biological variability in experimental planning

    • Consider technical replicates versus biological replicates

  • Data visualization and presentation:

    • Box plots for distribution data

    • Scatter plots with regression lines for correlation analysis

    • Survival curves for time-to-event data

    • Heat maps for multi-parameter analyses

In a recent study on Stard3 as a biomarker in HER2-positive breast cancer, researchers employed Chi-square tests with Yates's correction (or Fisher's exact tests for small sample sizes) for comparing qualitative variables. For quantitative variables, two-sided Wilcoxon tests were used. The predictive value was assessed using sensitivity, specificity, positive and negative predictive values with 95% confidence intervals .

What emerging roles of Stard3 beyond cholesterol transport warrant investigation?

Several potential functions of Stard3 beyond its established role in cholesterol transport merit further research:

  • Signaling pathway modulation:

    • Investigate how Stard3-mediated cholesterol redistribution affects lipid raft-dependent signaling

    • Explore potential direct interactions with signaling proteins

    • Examine cross-talk between Stard3 and other lipid transfer proteins in signaling regulation

  • Organelle morphology and dynamics:

    • Study how Stard3-mediated contacts influence endosome positioning and motility

    • Investigate the role of Stard3 in regulating endosome maturation and function

    • Explore potential impacts on autophagosome formation and autophagic flux

  • Inter-organelle communication networks:

    • Map the complete interactome of Stard3 to identify novel binding partners

    • Investigate Stard3's potential role in coordinating multiple organelle interactions

    • Study how Stard3 function integrates with other contact site proteins

  • Potential roles in non-cholesterol lipid transport:

    • Assess whether Stard3 can transport other sterols or lipid species

    • Investigate structure-function relationships that determine lipid specificity

    • Explore potential redundancy or cooperation with other lipid transfer proteins

Current research has demonstrated that Stard3 expression can alter endosomal morphology, promoting the formation of intraluminal vesicles and multilamellar structures within endosomes. This suggests a role in membrane remodeling that may have implications for processes such as exosome biogenesis, protein degradation, and organelle homeostasis .

How might emerging technologies advance our understanding of Stard3 function?

Novel technologies that could significantly enhance Stard3 research include:

  • Proximity labeling techniques:

    • Apply BioID or APEX2-based proximity labeling to identify proteins near Stard3 at contact sites

    • Map the spatial proteome at ER-endosome contacts

    • Identify transient or weak interactors that may be missed by traditional approaches

  • Advanced imaging technologies:

    • Implement lattice light-sheet microscopy for dynamic 3D visualization of contact sites

    • Use correlative light and electron microscopy (CLEM) to combine functional and ultrastructural analysis

    • Apply expansion microscopy to visualize nanoscale organization of contact site components

  • Lipid imaging advances:

    • Develop genetically encoded sensors for cholesterol in specific organelles

    • Apply click chemistry-based approaches for tracking lipid movement in living cells

    • Implement mass spectrometry imaging to map lipid distribution with spatial resolution

  • CRISPR-based approaches:

    • Generate endogenous fluorescent protein fusions to study Stard3 at physiological levels

    • Create conditional knockout systems for tissue-specific and temporal control

    • Develop CRISPR screens to identify genes affecting Stard3 function

  • Computational modeling:

    • Develop molecular dynamics simulations of Stard3-mediated lipid transfer

    • Create systems biology models of cholesterol homeostasis incorporating Stard3 function

    • Apply machine learning to predict functional outcomes of Stard3 mutations or expression changes

These technologies could help resolve outstanding questions about the kinetics of Stard3-mediated cholesterol transport, the composition and dynamics of ER-endosome contact sites, and the integration of Stard3 function within broader cellular lipid homeostasis networks.

What key questions remain unanswered regarding Stard3 regulation and function?

Despite significant advances, several fundamental questions about Stard3 remain to be addressed:

  • Regulatory mechanisms:

    • What kinases and phosphatases regulate Stard3 FFAT motif phosphorylation?

    • How is Stard3 expression regulated in different tissues and under varying metabolic conditions?

    • Are there additional post-translational modifications beyond phosphorylation that affect Stard3 function?

  • Functional coordination:

    • How does Stard3 function coordinate with other cholesterol transport pathways?

    • What determines the directionality of Stard3-mediated cholesterol transport?

    • How do cells balance Stard3 activity with other contact site proteins?

  • Pathophysiological relevance:

    • What is the precise contribution of Stard3 to HER2-positive cancer progression?

    • Are there diseases beyond cancer where Stard3 dysfunction plays a role?

    • Could Stard3 be a viable therapeutic target, and what would be the consequences of its inhibition?

  • Evolutionary aspects:

    • How has Stard3 function evolved across species?

    • What selective pressures have shaped Stard3's role in cholesterol homeostasis?

    • Do different organisms employ alternative mechanisms for ER-endosome cholesterol transfer?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.