Recombinant Mouse Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (Nsdhl)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us; we will prioritize its development.
Synonyms
Nsdhl; Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Nsdhl
Target Protein Sequence
MEQAVHGESKRGQVTGTHLTNDISKAKKCTVIGGSGFLGQHMVEQLLERGYTVNVFDIHQ GFDNPRVQFFIGDLCNQQDLYPALKGVSTVFHCASPPPYSNNKELFYRVNFIGTKTVIET CREAGVQKLILTSSASVVFEGVDIKNGTEDLPYAMKPIDYYTETKILQERAVLDANDPKK NFLTAAIRPHGIFGPRDPQLVPILIDAARKGKMKFMIGNGENLVDFTFVENVVHGHILAA EHLSQDAALGGKAFHITNDEPIPFWTFLSRILTGLNYEAPKYHIPYWMAYYLAFLLSLLV MVVSPLIQIQPTFTPIRVALAGTFHYYSCEKAKKLFGYRPLVTMDEAVERTVQSFHHLRK DK
Uniprot No.

Target Background

Function

This recombinant Mouse Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (Nsdhl) catalyzes the NAD(P)(+)-dependent oxidative decarboxylation of the C4 methyl groups of 4-alpha-carboxysterols in post-squalene cholesterol biosynthesis. It also plays a role in regulating the endocytic trafficking of EGFR.

Gene References Into Functions
  1. The role of NSDHL and cholesterol in postnatal central nervous system development is demonstrated. PMID: 25652406
  2. A novel SNP in Nsdhl suggests it as the causal gene for the HDL level QTL. PMID: 23979938
  3. This research identifies a critical role for SC4MOL and NSDHL in regulating EGFR signaling and endocytic trafficking, suggesting novel strategies for enhancing the efficacy of EGFR antagonists in tumors. PMID: 23125191
  4. Lethality in Nsdhl-deficient mouse embryos is rescued by transgenic mice expressing human Nsdhl. PMID: 19880419
  5. While NSDHL-deficient cells in mosaic Bpa(1H) females survive and differentiate during embryonic development, they undergo negative selection throughout the animal's lifespan. PMID: 19631568
Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Lipid droplet.

Q&A

What is the primary function of Nsdhl in cholesterol biosynthesis?

Nsdhl (NAD(P)H sterol dehydrogenase-like) functions as a critical enzyme in the cholesterol synthesis pathway. It catalyzes the NAD(P)(+)-dependent oxidative decarboxylation of the C4 methyl groups of 4-alpha-carboxysterols in post-squalene cholesterol biosynthesis . During cholesterol synthesis, the Nsdhl enzyme participates in converting lanosterol to cholesterol by removing a methyl group (a carbon atom and three hydrogen atoms) from lanosterol as part of an enzyme complex .

For optimal experimental design, researchers should note that Nsdhl requires NAD(P)+ as a cofactor and is functionally dependent on proper localization to the endoplasmic reticulum membrane and lipid droplets, where the enzymatic reactions occur .

How is Nsdhl expression regulated during mouse development?

Immunohistochemistry studies reveal distinctive tissue-specific Nsdhl expression patterns during mouse development. In wild-type mouse embryos, the highest expression levels are observed in the liver, dorsal root ganglia, central nervous system, retina, adrenal gland, and testis . This differential expression correlates with tissues that have high demands for cholesterol during development.

Postnatally, Nsdhl maintains high expression in the liver (a major site of cholesterol synthesis) and the brain (which depends on endogenous cholesterol synthesis due to the blood-brain barrier) . Within the brain, cerebral cortical and hippocampal neurons show particularly high expression levels.

When designing developmental studies, researchers should consider these tissue-specific expression patterns and temporal changes to properly interpret experimental results.

What phenotypes are associated with Nsdhl deficiency in mouse models?

The bare patches (Bpa) mouse model carries mutations in the Nsdhl gene, with Bpa1H representing a null allele. This model displays distinct sex-specific phenotypes due to the X-linked nature of the Nsdhl gene:

SexGenotypePhenotype
FemaleHeterozygous Bpa1HSkin and skeletal abnormalities in a pattern reflecting random X-inactivation
MaleHemizygous Bpa1HEmbryonic lethality before embryonic day 10.5

In heterozygous Bpa1H females, clonal populations of Nsdhl-deficient cells are detectable in the developing cerebral cortex and retina . Interestingly, the proportion of Nsdhl-negative cells decreases with age in multiple tissues, dropping from approximately 50% at postnatal day 6 to about 20% at one year of age in the liver, with similar reductions observed in the brain . This suggests a selective disadvantage for Nsdhl-deficient cells over time.

These phenotypes highlight the essential role of Nsdhl in development and cellular function, making it a valuable model for studying cholesterol-dependent developmental processes.

What structural features of Nsdhl are important for its enzymatic function?

X-ray crystallography has revealed critical structural insights into NSDHL, with two distinct conformational states identified:

Structural StateKey FeaturesFunctional Significance
Apo formEnzyme without bound cofactorBaseline conformation
Holo formEnzyme with bound coenzymeShows unique conformational changes essential for catalytic activity

The crystal structures provide detailed information about the coenzyme-binding site, which is crucial for enzyme function . The enzyme undergoes significant conformational changes upon coenzyme binding, which likely facilitate substrate positioning and catalysis .

Nsdhl is localized to the endoplasmic reticulum (ER) membrane and lipid droplets, with this subcellular localization being essential for accessing sterol substrates embedded in membranes . The enzyme's membrane association must be considered when designing experimental conditions for in vitro studies.

Understanding these structural details has been instrumental in structure-based inhibitor design approaches targeting NSDHL .

How does Nsdhl interact with the EGFR signaling pathway?

Beyond its canonical role in cholesterol biosynthesis, Nsdhl has emerged as a regulator of epidermal growth factor receptor (EGFR) trafficking pathways . This dual functionality positions Nsdhl at the intersection of cholesterol metabolism and growth factor signaling.

Specifically, Nsdhl plays a role in the regulation of EGFR endocytic trafficking, influencing receptor availability at the cell surface and subsequent signaling activities . Loss of Nsdhl gene expression has been demonstrated to sensitize cancer cells to EGFR-targeting inhibitors , suggesting a potential synthetic lethality that could be exploited therapeutically.

The molecular mechanism connecting Nsdhl activity to EGFR trafficking remains incompletely understood, but may involve:

  • Direct effects on membrane cholesterol composition affecting receptor mobility

  • Alterations in lipid raft formation necessary for EGFR signaling

  • Indirect effects through sterol intermediate accumulation

This connection provides a rationale for investigating Nsdhl as a potential target in EGFR-driven cancers and suggests that combined inhibition of Nsdhl and EGFR might offer synergistic therapeutic benefits .

What are the optimal techniques for detecting and measuring Nsdhl expression and activity?

Researchers have several complementary approaches available for studying Nsdhl:

TechniqueApplicationAdvantagesLimitations
ImmunohistochemistryTissue expression patternsPreserves spatial informationSemi-quantitative
Western blottingProtein expression levelsQuantitative protein detectionRequires tissue lysis
Microarray analysisGene expression changesGenome-wide perspectiveRNA levels may not reflect protein activity
Isothermal titration calorimetryCoenzyme binding kineticsDirect measurement of binding constantsRequires purified protein
Competitive inhibitor assayEnzyme inhibition studiesAdaptable to high-throughput screeningMay be affected by compound interference
Thermal shift assayProtein stability assessmentEvaluates conformational stabilityIndirect measure of function

For protein detection, commercial antibodies such as rabbit recombinant monoclonal NSDHL antibody have been validated for immunoprecipitation and Western blotting applications in human, mouse, and rat samples .

When measuring enzyme activity, it's essential to consider the membrane-associated nature of Nsdhl and its dependence on NAD(P)+ as a cofactor. Fluorescence-based assays measuring NADH levels (Ex/Em = 340/460 nm) have been successfully employed to evaluate inhibition profiles .

How can researchers effectively analyze the impact of Nsdhl mutations or inhibition?

When investigating the consequences of Nsdhl disruption, researchers should implement a multi-faceted experimental approach:

  • Biochemical analysis: Measure cholesterol levels and pathway intermediates using techniques such as liquid chromatography-mass spectrometry (LC-MS) to identify accumulating sterol precursors.

  • Gene expression profiling: Compare gene expression in Nsdhl-deficient versus wild-type cells using microarray or RNA-seq approaches to identify affected pathways .

  • Cellular phenotyping: Evaluate cell morphology, proliferation, and survival to determine the cellular consequences of Nsdhl deficiency.

  • EGFR signaling assessment: Analyze EGFR localization, degradation, recycling, and downstream signaling pathway activation in cells with altered Nsdhl expression .

  • Tissue-specific effects: In mosaic models like heterozygous Bpa females, compare Nsdhl-positive and Nsdhl-negative cell populations within the same tissue to identify cell-autonomous effects .

For mutation studies, thermal shift assays have been used to evaluate the stability of NSDHL mutants (such as G205S and K232Δ) compared to wild-type protein , providing insights into how specific mutations affect protein folding and function.

How can structure-based approaches be used to develop selective inhibitors of Nsdhl?

The availability of crystal structures for human NSDHL provides a foundation for rational inhibitor design. Structure-based virtual screening and biochemical evaluation have successfully identified novel inhibitors of NSDHL with suppressive activity towards EGFR .

The methodological workflow for structure-based inhibitor development includes:

  • Virtual screening: Use the crystal structure to identify compounds predicted to bind the coenzyme-binding site or other druggable pockets.

  • Biochemical validation: Test candidate compounds in enzyme inhibition assays, such as the competitive inhibitor assay described in the literature .

  • Structure-activity relationship (SAR) analysis: Synthesize and test analogs to optimize potency and selectivity.

  • Cellular validation: Evaluate effects on cholesterol synthesis and EGFR signaling in cellular models.

  • Combination studies: Test potential synergy with EGFR kinase inhibitors in cancer models .

The unique conformational change observed upon coenzyme binding presents an opportunity for developing allosteric inhibitors that could offer enhanced selectivity compared to active site inhibitors .

What are the implications of Nsdhl in cancer biology and potential therapeutic applications?

Emerging evidence positions Nsdhl as a potential therapeutic target in cancer, particularly through two mechanisms:

  • Cholesterol metabolism dependency: Cancer cells often have increased cholesterol requirements to support rapid proliferation. Inhibition of Nsdhl disrupts cholesterol synthesis and may lead to accumulation of potentially toxic sterol intermediates .

  • EGFR signaling modulation: Nsdhl regulates EGFR trafficking and signaling, with loss of Nsdhl sensitizing cancer cells to EGFR-targeting inhibitors .

In EGFR-driven human cancer cells, treatment with an NSDHL inhibitor enhanced the antitumor effect of an EGFR kinase inhibitor , suggesting potential for combination therapy approaches. This synergistic effect might allow for lower doses of both agents, potentially reducing side effects while maintaining efficacy.

Research questions that remain to be addressed include:

  • Which cancer types are most dependent on Nsdhl function?

  • What biomarkers predict sensitivity to Nsdhl inhibition?

  • How does Nsdhl inhibition affect other receptor tyrosine kinase signaling pathways?

  • What is the therapeutic window for Nsdhl inhibition?

How does Nsdhl deficiency contribute to CHILD syndrome pathophysiology?

CHILD syndrome (Congenital Hemidysplasia with Ichthyosiform nevus and Limb Defects) results from mutations in the X-linked NSDHL gene . The condition is characterized by unilateral abnormalities affecting the development of arms, legs, and other body parts, typically limited to one side of the body.

Most NSDHL mutations in CHILD syndrome either change single amino acids in the enzyme or delete portions of the gene . These mutations disrupt cholesterol synthesis through two potential mechanisms:

  • Cholesterol deficiency: Low cholesterol levels may impact developmental signaling pathways that require cholesterol, such as Hedgehog signaling, which is critical for limb development.

  • Toxic intermediate accumulation: The blockage in the cholesterol synthesis pathway may lead to the buildup of potentially toxic sterol intermediates in tissues .

The unilateral distribution of abnormalities in CHILD syndrome reflects the pattern of random X-inactivation in females, creating a mosaic of cells with normal and deficient Nsdhl function . This mosaic pattern provides a unique opportunity to study the cell-autonomous effects of Nsdhl deficiency within the same organism.

What considerations are important when using mouse models to study Nsdhl-related disorders?

The Bpa mouse model offers valuable insights into Nsdhl function but requires careful experimental design:

Experimental ConsiderationMethodological Approach
Sex differencesDue to X-linkage, analyze males and females separately; hemizygous males are embryonic lethal
Developmental timingConsider embryonic lethality in males; study heterozygous females at multiple developmental stages
Tissue mosaicismUse immunohistochemistry to distinguish Nsdhl-positive and Nsdhl-negative cell populations
Age-dependent changesAccount for the progressive decrease in Nsdhl-negative cells with age
Pathway analysisCombine gene expression profiling with sterol intermediate analysis

When interpreting results from Bpa mice, researchers should note the observed decline in Nsdhl-negative cells over time, dropping from approximately 50% at postnatal day 6 to about 20% at one year of age in the liver . This selection against Nsdhl-deficient cells suggests compensatory mechanisms that might confound long-term studies.

Microarray analysis comparing gene expression in embryonic fibroblasts expressing the Bpa1H allele versus wild-type cells can provide insights into the molecular basis of defects associated with Nsdhl deficiency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.