Recombinant Mouse Sterol regulatory element-binding protein 1 (Srebf1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Srebf1; Srebp1; Sterol regulatory element-binding protein 1; SREBP-1; Sterol regulatory element-binding transcription factor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-480
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTG PSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPSAPAALKMYPSVSPFSPGPGI KEEPVPLTILQPAAPQPSPGTLLPPSFPAPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQP PSSLPLAPAPGVLPTPALHTQVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKA DSLLLTAVKTDAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIH RLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKA IDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTP PPSDAGSPSQSSPLSFGSRASSSGGSDSEPDSPAFEDSQVKAQRLPSHSRGMLDRSRLAL
Uniprot No.

Target Background

Function
Sterol regulatory element-binding protein 1 (SREBP-1) is a precursor to a transcription factor form. Membrane-bound in the endoplasmic reticulum, it undergoes processing in response to low sterol concentrations. This releases the transcription factor form, which translocates to the nucleus and activates genes involved in cholesterol biosynthesis and lipid homeostasis. A key regulator of genes involved in cholesterol biosynthesis and lipid homeostasis, SREBP-1 binds to sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). It exhibits dual sequence specificity, binding to both an E-box motif (5'-ATCACGTGA-3') and SRE-1. It regulates promoters of genes involved in cholesterol biosynthesis and the LDL receptor (LDLR) pathway. SREBP-1A, predominantly expressed in most tissues, has weaker transcriptional activity than SREBP-1A, primarily controlling lipogenic gene expression and strongly activating lipid synthesis in rapidly growing cells. In contrast, SREBP-1A, expressed only in specific tissues, exhibits higher transcriptional activity, stimulating both lipogenic and cholesterogenic gene expression and playing a crucial role in nutritional regulation of fatty acids and triglycerides in lipogenic organs (e.g., liver), and innate immune response in macrophages by regulating lipid metabolism.
Gene References Into Functions
  1. Adenosine 2A receptor (A2AR) suppresses hepatocyte fat deposition by repressing SREBP1c expression and transcription activity under fasted states. PMID: 29315766
  2. Cidea, highly associated with alcoholic fatty liver disease, is induced by acetaldehyde, likely mediated by SREBP1c. PMID: 29352167
  3. Disrupting SREBP-1a phosphorylation significantly alters cellular processes, impacting lipid pathway targeting. PMID: 29587401
  4. SREBP-1 modestly contributes to maintaining insulin signal transduction in the liver, primarily under fasting conditions. PMID: 29723221
  5. Kdm1a attenuates Srebf1 transcriptional activities, suppressing de novo lipogenesis by oxidative stress in white adipose tissue. PMID: 29618580
  6. Tlr4-mutant mice exhibit resistance to acute alcohol-induced hepatic SREBP-1 activation and lipid accumulation. PMID: 27627966
  7. LncARSR promotes hepatic lipogenesis via the Akt/SREBP-1c pathway, contributing to nonalcoholic steatohepatitis pathogenesis. PMID: 29555473
  8. Glrx(-/-) mice exhibit decreased SirT1 activity, leading to SREBP-1 hyperacetylation, activation, and upregulation of lipid synthesis enzymes. PMID: 27958883
  9. NAMPT inhibition aggravates high-fat diet-induced hepatic steatosis by regulating the Sirt1/AMPKalpha/SREBP1 pathway. PMID: 28449683
  10. SREBP1 is dramatically reduced in dysbindin-1 knockout mice, potentially linking to cognitive deficits. PMID: 26873854
  11. Epidermal growth factor receptor (EGFR) signaling enhances miR-29 expression in glioblastoma cells via SREBP-1 upregulation. PMID: 27477273
  12. hHL promotes hepatic triglyceride accumulation and de novo lipogenesis, upregulating Srebf1 and fatty acid synthesis genes, leading to increased adiposity and FFA influx into WAT. PMID: 29244870
  13. miR-200b and miR-200c bind JUN's 3' UTR, and JUN activates srebp1 transcription, increasing lipid accumulation. PMID: 27166182
  14. SREBP-1 acts as a cell surface retention factor for TbetaRI in mesangial cells. PMID: 27826032
  15. Srebp1c is a key regulator of metabolic remodeling, contributing to caloric restriction's benefits. PMID: 28256090
  16. C/EBPbeta and LXRalpha are required for insulin-mediated induction of SREBP-1c mRNA expression in rodent liver. PMID: 27382175
  17. Srebf-2 deletion lowers sterol synthesis, eliminating the sterol ligand needed for LXR activity and SREBP-1c expression. PMID: 28244871
  18. KLF15, a gluconeogenesis regulator, forms a complex with LXR/RXR on the Srebf1 promoter. PMID: 27545894
  19. Early xenobiotic exposure induces persistent fat accumulation via lipogenic gene hypomethylation and increased Nrf2 recruitment to the Srebp-1c promoter. PMID: 28796629
  20. SREBP-1c impacts neurosteroidogenesis. PMID: 28467654
  21. TAK1 regulation of SREBPs maintains liver homeostasis, preventing steatosis and HCC development. PMID: 26973245
  22. miR-185 negatively regulates 3T3-L1 cell differentiation by targeting SREBP-1. PMID: 28701079
  23. The SREBP1 pathway plays a crucial role in hepatocellular carcinoma pathogenesis. PMID: 28027595
  24. In hepatocytes, E4BP4 interacts with nuclear SREBP-1c, preserving its acetylation and preventing ubiquitination-dependent degradation. PMID: 27252523
  25. SREBP1 contributes to resolving TLR4-induced gene activation by reprogramming macrophage lipid metabolism. PMID: 28041958
  26. 27OH is not a significant regulator of Srebp- or LXR-regulated genes under basal conditions in mouse liver. PMID: 26851362
  27. LXRalpha activation induces 17beta-HSD13 expression in an SREBP-1c-dependent manner. PMID: 28270440
  28. HDAC3 and SCAP control symbiotic liver lipid metabolism pathways, suppressing lipotoxicity. PMID: 27866836
  29. ATF4 regulates SREBP1c expression to control fatty acid synthesis. PMID: 27452504
  30. Luteolin abolishes LXR-SREBP-1c-induced lipid accumulation in vivo and in vitro. PMID: 27888103
  31. PLIN2 determines hepatic lipidome changes, potentially contributing to SREBP-regulated de novo lipogenesis in non-alcoholic fatty liver disease. PMID: 27679530
  32. ChREBP and SREBP-1c synergistically induce Elovl6 expression in the liver. PMID: 27524233
  33. MALAT1 promotes hepatic steatosis and insulin resistance by increasing nuclear SREBP-1c protein stability. PMID: 26935028
  34. Advanced glycation end product overproduction increases lipogenesis by activating SREBP-1c. PMID: 26721591
  35. Srebp-1 interacts with c-Myc, facilitating its binding to downstream pluripotent targets. PMID: 26388522
  36. SREBP1a or -1c repress rarg2; downregulating srebf1a removes this repression. PMID: 26271478
  37. SREBP-2 is critical for developmental survival and limb patterning. PMID: 26685326
  38. Dietary fibers decrease SREBP-1 and lipogenesis factor expression. PMID: 26510459
  39. Insulin inhibits cardiac UCP3 expression via SREBP-1 activation. PMID: 26555260
  40. Srebf1c deficiency causes blunted peripheral nerve fatty acid synthesis, resulting in neuropathy. PMID: 25817536
  41. An NCE-box in the clusterin promoter is necessary for insulin-stimulated hepatic clusterin expression via SREBP-1c. PMID: 26282207
  42. Smad3 and SREBP-1a cooperatively regulate TGFbeta transcriptional responses. PMID: 25348957
  43. Endoplasmic reticulum stress and SREBP-1-dependent effects are induced in angiotensin II-infused mice glomeruli. PMID: 25398788
  44. Mice with human miR-33b inserted into Srebf1 intron have reduced HDL cholesterol. PMID: 24931346
  45. CRTC2 mediates mTOR signaling, modulating COPII-dependent SREBP1 processing. PMID: 26147081
  46. Thyrotropin increases hepatic triglyceride content by upregulating SREBP-1c activity. PMID: 25016220
  47. LBP activates AMPK phosphorylation, suppressing nuclear SREBP-1c expression and lipogenic gene expression. PMID: 25013763
  48. Fucoidan from Acaudina molpadioides suppresses SREBP-1c, C/EBPa, and PPARg mRNA expression. PMID: 24847504
  49. LXR agonist TO901317 increases hepatic fatty acid desaturation via LXRalpha-dependent and SREBP1c-mediated SCD1 induction. PMID: 23945440
  50. DEC1 regulates Srebp-1c expression, linking circadian rhythm to hepatic lipogenesis; DEC1 activation alleviates nonalcoholic fatty liver phenotype. PMID: 24993831
Database Links
Protein Families
SREBP family
Subcellular Location
[Sterol regulatory element-binding protein 1]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 1]: Nucleus.
Tissue Specificity
[Isoform SREBP-1C]: Predominant isoform expressed in most tissues. Predominates in liver, adrenal gland, brain and adipose tissue. Also found in kidney, thymus, testis, muscle, jejunum, and ileum.; [Isoform SREBP-1A]: Expressed only in select tissues, suc

Q&A

What are the main isoforms of SREBP-1 and how do they differ functionally?

Mouse SREBP-1 exists in two major isoforms: SREBP-1a and SREBP-1c, which are generated by alternative splicing of the first exon of the SREBF1 gene. Their functional differences include:

  • SREBP-1a: Has higher transcriptional activity compared to SREBP-1c and can stimulate both lipogenic and cholesterogenic gene expression. It plays roles in nutritional regulation of fatty acids and triglycerides in lipogenic organs and is required for innate immune response in macrophages by regulating lipid metabolism .

  • SREBP-1c: Is the predominant isoform expressed in most tissues but has weaker transcriptional activity compared to SREBP-1a. It primarily controls expression of lipogenic genes and strongly activates global lipid synthesis in rapidly growing cells .

Recent research shows that in porcine adipose tissue, SREBF1c is the predominant isoform, similar to patterns observed in human adipose tissue depots .

What is the regulatory mechanism of SREBP-1 activation?

SREBP-1 activation involves a complex regulatory pathway:

  • SREBP-1 is initially synthesized as a precursor protein embedded in the endoplasmic reticulum membrane .

  • Under low sterol concentrations, the precursor undergoes proteolytic processing in the Golgi apparatus.

  • The cleaved mature form (Processed sterol regulatory element-binding protein 1) translocates into the nucleus.

  • In the nucleus, it binds to specific DNA sequences, primarily the sterol regulatory element 1 (SRE-1) with the consensus sequence 5'-ATCACCCCAC-3', as well as E-box motifs (5'-ATCACGTGA-3') .

  • This binding activates transcription of target genes involved in cholesterol biosynthesis and lipid homeostasis.

The pathway can be inhibited by sterols, which prevent the proteolytic cleavage of the precursor protein .

What are effective methods for studying SREBF1 function in mice?

Key methodological approaches for investigating SREBF1 function include:

MethodDescriptionApplicationsLimitations
CRISPR/Cas9 gene editingCreating specific deletions or modifications in the SREBF1 geneStudying isoform-specific functions, as demonstrated in the deletion of 5'-regulatory region specific to SREBF1c Potential off-target effects
ChIP-seqChromatin immunoprecipitation followed by high-throughput sequencingIdentifying genome-wide SREBP-1 binding sites Requires high-quality antibodies and can be technically challenging
Knockout/Knock-in modelsComplete gene knockout or humanized models with specific gene insertionsCreating miR-33b knock-in mice to study human-specific regulation Phenotypic differences from humans
Lipidomics profilingLC-MS/MS screening of lipid mediatorsIdentifying specific lipids regulated by SREBF1 Complex data interpretation
RNA-sequencingGenome-wide transcriptome analysisComparing gene expression between knockout and wild-type models Secondary effects may complicate analysis

For optimal results, researchers should implement multiple complementary approaches to validate findings across different experimental systems.

How can researchers differentiate between SREBP-1a and SREBP-1c functions experimentally?

Differentiating between the functions of SREBP-1a and SREBP-1c requires specialized approaches:

  • Isoform-specific primers: Design RT-PCR primers targeting the unique first exons of each isoform to quantify their differential expression .

  • Isoform-specific CRISPR/Cas9 targeting: Target the 5'-regulatory region specific to SREBF1c while preserving SREBF1a function, as demonstrated in porcine AD-MSC models .

  • Cell-type specific analysis: Compare expression patterns in different cell types, as SREBP-1a is predominantly expressed in certain cell lines (e.g., SGBS human preadipocytes), while SREBP-1c dominates in most tissues .

  • Temporal expression analysis: Monitor changes in isoform expression during differentiation processes, as demonstrated in adipogenesis studies showing distinct expression patterns for each isoform .

  • Target gene analysis: Assess differential regulation of specific target genes, as SREBP-1a influences both lipogenic and cholesterogenic genes, while SREBP-1c primarily regulates lipogenic genes .

When interpreting results, researchers should account for species-specific differences, as expression patterns may vary between mice, pigs, and humans.

How does SREBF1 respond to mechanical cues and what are the implications for disease models?

SREBF1 has been identified as a mechanosensitive transcription factor that responds to physical forces:

  • Mechanical regulation pathway: Activation of SREBP-1 is influenced by acto-myosin contractility and mechanical forces imposed by the extracellular matrix (ECM). This regulation depends on geranylgeranyl pyrophosphate, a key bio-product of the mevalonate pathway .

  • Mechanistic details: ECM stiffening and geranylgeranylated RhoA-dependent acto-myosin contraction activate AMP-activated protein kinase (AMPK), which inhibits SREBP-1 activation .

  • Evolutionary conservation: This mechanosensitive regulation is conserved from Drosophila to mammals, suggesting fundamental importance in cellular adaptation to mechanical environments .

  • Stem cell fate implications: Mechanical regulation of SREBP-1 impacts stem cell differentiation pathways in mice and fat storage in Drosophila, indicating a role in determining cell lineage commitment under different mechanical conditions .

  • Disease relevance: This mechanism may be particularly important in understanding conditions where tissue mechanics are altered, such as fibrosis, cancer, and musculoskeletal disorders.

These findings reveal an unprecedented connection between mechanical signals and metabolic rewiring through SREBP-1, expanding our understanding of how physical forces influence cellular metabolism and fate decisions.

What is the relationship between SREBF1 and bone-muscle homeostasis?

Recent research has revealed SREBF1 as a functional bone-muscle pleiotropic gene:

  • Genetic association: Genome-wide analysis of bone mineral density (BMD) and muscle mass identified SREBF1 as a significant factor affecting both tissues .

  • Bone effects: In zebrafish SREBF1 knockout models, adult fish demonstrated significantly lower bone mineral density compared to wild-type siblings (p < 0.03), confirming SREBF1's importance for bone homeostasis .

  • Lipid mediator regulation: SREBF1 knockout in zebrafish altered specific lipid mediators, with 11,12-epoxyeicosatrienoic acid (11,12-EET) levels being negatively associated with the number of SREBF1 alleles (p = 0.006) .

  • Muscle impact: In skeletal muscle, SREBP-1 indirectly downregulates the expression of MYOD1, MYOG, and MEF2C. Overexpression of SREBP-1 inhibits myoblast-to-myotube differentiation and leads to loss of muscle-specific proteins in differentiated myotubes .

  • Pathway enrichment: RNA-sequencing analysis of SREBF1 knockout zebrafish identified significantly enriched pathways including fatty acid elongation, linoleic acid metabolism, arachidonic acid metabolism, adipocytokine signaling, and DNA replication .

This multi-tissue influence suggests SREBF1 as a potential therapeutic target for treating comorbid conditions affecting both bone and muscle tissues.

What are the consensus binding motifs for SREBP-1 and how are they identified?

SREBP-1 binds to specific DNA sequences through well-characterized motifs that can be identified through multiple approaches:

  • Known consensus sequences:

    • Sterol Regulatory Element 1 (SRE-1): 5'-ATCACCCCAC-3'

    • E-box motif: 5'-ATCACGTGA-3'

  • Newly identified motifs: Genome-wide ChIP-seq analysis revealed a previously undescribed motif 5'-ACTACANNTCCC-3' present in 76% of SREBP-1 binding peaks in mouse liver. Functional studies confirmed this as a genuine SREBP-1 response element .

  • Co-regulatory elements: Sp1 consensus sites are frequently found within 150bp of SREBP-1 binding peaks (present in 50% of peaks), indicating cooperative transcriptional regulation. Other known co-regulators include NF-Y/CBF and CREB, though genome-wide analysis did not show significant enrichment of these factors .

  • Methodological approach: ChIP-seq experiments using liver chromatin from mice fed a high-carbohydrate diet after fasting (to superinduce SREBP-1c expression) identified 426 SREBP-1 binding peaks. These peaks showed striking enrichment in proximal promoter regions, with 52% located within 1kb upstream of transcription start sites .

This detailed understanding of SREBP-1 binding preferences has revealed that the newly identified motif corresponds to an "orphan motif" previously found in over 500 human promoters and conserved across mammalian species, suggesting SREBP-1c as the previously unidentified transcription factor responsible for this regulatory element .

How efficient is SREBP-1 as a transcription factor and what factors enhance its activity?

SREBP-1 exhibits unique characteristics as a transcription factor:

  • Intrinsic efficiency: SREBP-1 is considered an inefficient transcription factor when acting alone, requiring cooperation with other factors for robust gene activation .

  • Co-regulatory partners: Several co-regulatory proteins significantly enhance SREBP-1 transcriptional activity:

    • Sp1: Found within 150bp of 50% of SREBP-1 binding peaks

    • NF-Y/CBF: Critical co-regulator in some SREBP-responsive promoters

    • CREB: Functions as co-regulator in specific promoter contexts

  • Synergistic activation: Functional studies show that mutation of a single SREBP-1 binding element in promoters with multiple elements results in substantial loss of SREBP responsiveness, demonstrating the cooperative nature of SREBP-1-mediated transcription .

  • Nutritional regulation: SREBP-1 activation is strongly influenced by dietary conditions, with high-carbohydrate diets after fasting inducing substantial hepatic SREBP-1c expression .

  • Isoform-specific activity: SREBP-1a has higher intrinsic transcriptional activity compared to SREBP-1c, likely due to structural differences in their activation domains .

This understanding of SREBP-1's transcriptional mechanics helps explain why its binding must occur in specific genomic contexts with appropriate co-regulators to achieve functional gene regulation.

What are the key differences between mouse and human SREBF1 gene regulation?

Significant regulatory differences exist between mouse and human SREBF1:

  • MicroRNA regulation: Primates, including humans, express miR-33b from an intron of SREBF1, while rodents do not. This miR-33b appears to function as a feedback mechanism to regulate its host gene SREBF1 .

  • HDL-C impact: Mouse models with human miR-33b knocked into the Srebf1 intron show approximately 35% reduction in HDL-C levels compared to control mice, suggesting miR-33b may account for lower HDL-C levels in humans than in mice .

  • Target gene effects: In miR-33b knock-in mice, protein levels of known miR-33a target genes such as ABCA1, ABCG1, and SREBP-1 were reduced compared to wild-type mice, affecting cholesterol efflux capacity .

  • Isoform expression patterns: While both species express SREBP-1a and SREBP-1c isoforms, their tissue-specific expression patterns and relative abundance may differ between species .

  • Disease associations: In humans, SREBF1 variants have been associated with type 2 diabetes, glycemia, and insulin resistance, as well as with Mucoepithelial Dysplasia, Hereditary and Ifap Syndrome 2 .

These differences highlight the importance of using appropriate models when studying SREBF1 function and considering species-specific regulatory mechanisms when translating findings from mouse models to human applications.

How can humanized mouse models advance SREBF1 research?

Humanized mouse models offer valuable approaches for addressing cross-species differences in SREBF1 research:

  • MiR-33b knock-in models: Researchers have successfully established miR-33b knock-in mice by inserting the human miR-33b transgene within the mouse Srebf1 intron. These models demonstrate:

    • Reduced protein levels of miR-33 target genes (ABCA1, ABCG1, SREBP-1)

    • Reduced macrophage cholesterol efflux capacity

    • Decreased HDL-C levels by 35% even in heterozygous mice

  • Applications for disease modeling: These humanized models allow evaluation of:

    • Human-specific regulatory mechanisms in various genetic disease contexts

    • Feedback regulation of SREBF1 by its intronic miR-33b

    • Potential therapeutic approaches targeting human-specific pathways

  • Methodological considerations: When developing humanized SREBF1 models, researchers should:

    • Maintain the genomic context of regulatory elements

    • Verify expression patterns match human patterns

    • Assess functional outcomes across multiple relevant tissues

    • Compare results with human cellular models when possible

  • Limitations: Researchers should be aware that:

    • Some regulatory elements may still function differently in the mouse genomic context

    • Mouse-specific metabolic differences may influence phenotypic outcomes

    • Complete recapitulation of human regulation may require additional modifications

These models represent important tools for bridging the gap between basic mouse studies and human SREBF1 biology, potentially accelerating translational research in metabolic disorders, cardiovascular disease, and other SREBF1-related conditions.

How does SREBF1 contribute to cancer cell metabolism?

SREBF1 plays crucial roles in cancer cell metabolism through multiple mechanisms:

  • Lipid synthesis regulation: Cancer cells utilize lipids as building blocks for rapid proliferation, and SREBF1 functions as a master regulator of lipogenic pathways. Inhibition of SREBF1 has been hypothesized to reduce cancer cell growth and progression .

  • Response to DNA damage: Research using the Schizosaccharomyces pombe SREBF1 homolog (Sre1) demonstrated that:

    • When subjected to UV damage, cell viability decreases more substantially in sre1 mutant strains than in wildtype

    • Following DNA damage, lipid levels increased in the sre1 mutant relative to wild type cells

    • This suggests Sre1/SREBF1 is required for genotoxic stress response and maintains lipid homeostasis under conditions favoring cancer progression

  • Mutation patterns: Analysis using the Catalogue of Somatic Mutations in Cancer (COSMIC) identified mutations in SREBF1 across different cancer types, with statistical correlations to tissue type, age, and pathogenicity .

  • Mechanistic pathway: SREBF1 appears to play a critical role in deploying homeostatic balance in the aftermath of genotoxic insults, potentially explaining why alterations in this pathway affect cancer progression .

These findings suggest SREBF1 as a potential therapeutic target for cancer treatment, particularly in contexts where altered lipid metabolism drives tumor growth and resistance to genotoxic therapies.

What are the implications of SREBF1 in metabolic disorders and potential therapeutic approaches?

SREBF1 has significant implications for metabolic disorders and represents a promising therapeutic target:

  • Metabolic syndrome association: Research indicates that SREBF1:

    • Regulates genes involved in cholesterol biosynthesis and lipid homeostasis

    • Has variants associated with type 2 diabetes, glycemia, and insulin resistance in humans

    • Influences adipogenesis and fat storage

  • Adipose tissue regulation: SREBF1c is the predominant isoform in adipose tissue and:

    • Controls lipogenic gene expression

    • Plays a key role in adipocyte differentiation

    • May influence fat distribution patterns relevant to metabolic health

  • Therapeutic targeting considerations:

    ApproachMechanismPotential BenefitsChallenges
    Isoform-specific inhibitionTargeting SREBF1c while preserving SREBF1a functionReduced lipogenesis while maintaining essential functionsRequires highly specific molecular tools
    miR-33 modulationTargeting the regulatory miRNA networkMay improve cholesterol efflux and HDL-C levelsDifferent effects in humans vs. mice due to miR-33b
    Pathway-specific interventionTargeting specific downstream pathwaysReduced side effects by avoiding complete SREBF1 inhibitionComplex feedback mechanisms may limit efficacy
    Nutritional/mechanical regulationExploiting natural regulatory mechanismsMore physiological approach with fewer side effectsMay have limited potency in severe disease states
  • Bone-muscle considerations: Given SREBF1's role in bone and muscle homeostasis, therapeutic approaches should carefully consider potential effects on these tissues, as SREBF1 knockout in zebrafish resulted in significantly lower bone mineral density .

The multifaceted roles of SREBF1 suggest that therapeutic strategies may need to be tissue-specific and consider the broader metabolic and structural impacts beyond simple lipid regulation.

What expression systems are most effective for producing functional recombinant mouse SREBF1?

Producing functional recombinant mouse SREBF1 presents unique challenges due to its membrane-bound precursor nature and requirement for proteolytic processing. Based on research methodologies, effective expression systems include:

  • Mammalian expression systems:

    • HEK293 cells provide proper post-translational modifications and processing machinery

    • CHO cells offer stable expression for long-term production

    • These systems allow for the study of both precursor and processed forms of SREBP-1

  • Domain-specific expression:

    • The N-terminal transcription factor domain (processed form) can be expressed in E. coli for structural and functional studies

    • For the precursor form, insect cell systems like Sf9 using baculovirus vectors are preferred

  • Design considerations:

    • Include appropriate tags (His, FLAG) for purification without interfering with function

    • For studying the precursor-to-mature form transition, systems must include SCAP and S1P/S2P proteases

    • Expression of SREBP-1a vs. SREBP-1c requires careful design of constructs with the correct first exon

  • Verification methods:

    • DNA binding assays using known SREBP-1 responsive elements (SRE, E-box motifs)

    • Immunoblotting to verify both precursor (~125 kDa) and mature (~68 kDa) forms

    • Nuclear localization assessment for processed forms

These approaches must consider the specific experimental goals, whether studying processing mechanisms, DNA binding, or protein-protein interactions involving SREBF1.

What are the critical quality control parameters for recombinant SREBF1 in experimental applications?

When using recombinant SREBF1 for experimental applications, several critical quality control parameters should be assessed:

  • Structural integrity verification:

    • SDS-PAGE to confirm correct molecular weight of both precursor (~125 kDa) and processed forms (~68 kDa)

    • Circular dichroism to verify proper secondary structure, particularly the helix-loop-helix-leucine zipper domain

    • Limited proteolysis to assess domain folding and accessibility

  • Functional validation:

    • DNA binding activity using electrophoretic mobility shift assays with known SREBP-1 binding motifs (SRE-1, E-box, and the newly identified 5'-ACTACANNTCCC-3' motif)

    • Reporter gene assays to confirm transcriptional activation capacity

    • Co-immunoprecipitation with known interaction partners (e.g., Sp1)

  • Isoform authentication:

    • Mass spectrometry to confirm the N-terminal sequence differentiating SREBP-1a from SREBP-1c

    • Isoform-specific antibody recognition

    • Comparative functional analysis with isoform-specific activities

  • Stability assessment:

    • Temperature stability profiles to ensure consistent activity during experimental use

    • Freeze-thaw stability testing

    • Storage condition optimization to maintain activity

  • Batch consistency:

    • Lot-to-lot comparison of DNA binding activity

    • Standardized activity units based on transcriptional activation of target promoters

    • Consistent post-translational modification patterns

These quality control measures ensure that experimental results using recombinant SREBF1 are reproducible and physiologically relevant, particularly important given the complex regulation and processing requirements of this transcription factor.

What emerging technologies will advance our understanding of SREBF1 regulation and function?

Several cutting-edge technologies are poised to transform SREBF1 research:

  • Spatial transcriptomics and proteomics:

    • Will enable tissue-specific mapping of SREBF1 isoform expression with subcellular resolution

    • Can reveal context-dependent regulation in different microenvironments

    • Will help understand how mechanical forces influence SREBF1 activation in tissue-specific contexts

  • Single-cell multi-omics:

    • Single-cell RNA-seq combined with ATAC-seq will reveal cell-specific SREBF1 target gene networks

    • Can identify heterogeneous responses within tissues during metabolic challenges

    • Will help clarify the temporal sequence of SREBF1-mediated transcriptional cascades

  • Advanced genome editing technologies:

    • Base editing and prime editing for precise modification of SREBF1 regulatory elements

    • Multiplex CRISPR screens to systematically identify functional SREBF1 domains and regulatory partners

    • Tissue-specific and inducible CRISPR systems for temporal control of SREBF1 disruption

  • AI-powered structural biology:

    • AlphaFold and similar platforms will predict structures of SREBF1 in different conformational states

    • Molecular dynamics simulations to understand allosteric regulation

    • Structure-based drug design targeting specific SREBF1 domains or isoforms

  • Organ-on-chip and organoid technologies:

    • Will enable studies of SREBF1 function in complex cellular environments

    • Can incorporate mechanical stimuli to study mechanosensitive regulation

    • Will facilitate human-relevant discoveries with greater translational potential

These technologies will help resolve current contradictions in SREBF1 research, particularly regarding tissue-specific functions and the differing roles of SREBP-1a versus SREBP-1c in development and disease.

How might integrative multi-tissue analysis advance our understanding of SREBF1's pleiotropic effects?

An integrative multi-tissue approach offers promising avenues for unraveling SREBF1's complex pleiotropic effects:

  • Systems biology frameworks:

    • Network analysis integrating transcriptomics, proteomics, and lipidomics data across tissues

    • Mathematical modeling of SREBF1-mediated cross-tissue communication

    • Identification of tissue-specific and shared regulatory circuits

  • Multi-tissue temporal profiling:

    • Synchronized sampling across bone, muscle, liver, and adipose tissues during metabolic challenges

    • Correlation of tissue-specific SREBF1 activation with circulating factors

    • Identification of sequential activation patterns suggesting causal relationships

  • Tissue crosstalk experiments:

    • Co-culture systems combining different SREBF1-expressing tissues

    • Exosome and secretome analysis to identify inter-tissue signaling molecules

    • Selective tissue-specific knockout models with comprehensive phenotyping

  • Integrated stress response analysis:

    • Examining how SREBF1 coordinates responses to various stressors across tissues

    • Investigating the relationship between DNA damage responses and metabolic adaptation

    • Understanding how mechanical stress signals propagate between tissues

  • Translational approaches:

    • Multi-tissue biopsies from patients with metabolic disorders

    • Correlation of tissue-specific SREBF1 activity with clinical outcomes

    • Development of composite biomarkers reflecting multi-tissue SREBF1 function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.