Recombinant Mouse Sterol regulatory element-binding protein 2 (Srebf2)

Shipped with Ice Packs
In Stock

Description

Production and Characterization

Recombinant SREBF2 is produced through heterologous expression systems, often in bacterial, yeast, or mammalian cells, with purification tags (e.g., Strep Tag) for efficient isolation . Key characteristics include:

ParameterDetailsSource
Host OrganismsE. coli, yeast, baculovirus, or mammalian cells (e.g., tobacco plants )
Purity≥85% by SDS-PAGE analysis
TagStrep Tag (e.g., ABIN3135009 from Nicotiana tabacum)
ApplicationsWestern blot, ELISA, SDS-PAGE, functional assays

These recombinant proteins retain the native bHLH-Zip domain required for DNA binding and dimerization with other transcription factors .

Research Applications

Recombinant SREBF2 is utilized to study its role in lipid metabolism, inflammation, and disease pathogenesis. Key findings include:

Cholesterol Homeostasis

SREBF2 regulates genes critical for cholesterol biosynthesis (e.g., HMGCR, LDLR) and uptake . In sterol-depleted conditions, recombinant SREBF2 activates these targets, mimicking endogenous responses .

Bone Metabolism

Myeloid-specific SREBF2 deficiency exacerbates osteoclastogenesis and bone resorption in mice, highlighting its protective role in inflammatory bone loss .

Inflammation and Immune Response

SREBF2 upregulates NLRP3 inflammasome components, linking lipid metabolism to inflammatory pathways . In endothelial cells, oscillatory shear stress activates SREBF2, increasing reactive oxygen species (ROS) and NLRP3 expression .

Nuclear Import Pathway

Recombinant SREBF2’s mature form (N-terminal fragment) enters the nucleus via importin β-mediated transport, independent of importin α . Ran-GTP binding disrupts the SREBF2-importin β complex, enabling nuclear translocation .

Gene Targets and Interactions

SREBF2 binds sterol regulatory elements (SREs) in promoters of target genes (e.g., HMG-CoA synthase, LDL receptor) . It also regulates T2R bitter taste receptors in enteroendocrine cells, linking cholesterol sensing to gut peptide secretion .

Gene/PathwayFunctionSource
HMGCRRate-limiting enzyme in cholesterol synthesis
LDLRMediates LDL cholesterol uptake
NLRP3Inflammasome component; promotes IL-1β secretion
T2R138Bitter taste receptor; modulates CCK secretion

Disease Models

  • COVID-19: SREBF2 activation correlates with cytokine storm severity; its inhibition reduces mortality in sepsis models .

  • Osteoporosis: SREBF2 deficiency enhances osteoclast activity, suggesting therapeutic targeting in inflammatory bone diseases .

  • Cardiovascular Disease: Recombinant SREBF2 overexpression increases endothelial cholesterol content and ROS, linking dyslipidemia to vascular dysfunction .

Diagnostic Tools

ELISA kits (e.g., MOEB1031) measure SREBF2 levels in serum, plasma, and cell culture supernatants, with a detection range of 0.312–20 ng/mL and sensitivity of 0.166 ng/mL .

Disease-Associated Pathways

DiseaseMechanismSource
AtherosclerosisIncreased LDLR expression enhances cholesterol uptake in endothelial cells
OsteoporosisSREBF2 deficiency ↑ osteoclast differentiation via TNFα/RANKL signaling
SepsisSREBF2 inhibition reduces NLRP3 activation and improves survival

Product Specs

Form
Supplied as a lyophilized powder.

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will accommodate your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request and will incur additional charges. Please contact us in advance to arrange this.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
Srebf2; Srebp2; Sterol regulatory element-binding protein 2; SREBP-2; Sterol regulatory element-binding transcription factor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-473
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDESSELGVLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGGGSN GGSGNNSSGRGNNGGATDPAVQRSFSQVPLSTFSPSAASPQAPALQVKVSPTPPRATPVL QPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTS PQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTD SLVLTTLKTDGSPVMAAVQNPALTALTAPIQTAALQVPTLVGSNGTILTTMPVMMGQEKV PIKQVPGGVKQLDPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSGVLR KAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIDDFNQNVLLM SPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILL
Uniprot No.

Target Background

Function

Sterol regulatory element-binding protein 2 (SREBP2) is a precursor to a transcription factor form (processed SREBP2) that resides within the endoplasmic reticulum membrane. Low sterol concentrations trigger the processing of this precursor, releasing the transcription factor form. This active form translocates to the nucleus, where it activates the transcription of genes involved in cholesterol biosynthesis. SREBP2 is a crucial transcription factor regulating the expression of genes involved in cholesterol synthesis, binding specifically to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). It also exhibits dual sequence specificity, binding to both an E-box motif (5'-ATCACGTGA-3') and SRE-1, thereby regulating the transcription of genes within the cholesterol synthesis pathway.

Gene References Into Functions
  1. Hexacosanol activates AMPK and hepatic autophagy, inhibiting SREBP2, leading to hypocholesterolemic effects and improved hepatic steatosis. PMID: 28676202
  2. Increased SREBP-2 directly activates the expression of PNPLA8 (patatin-like phospholipase domain-containing enzyme 8), which associates with autophagosomes and reduces cellular triglycerides. PMID: 27767079
  3. SCAP (SREBP cleavage-activating protein) re-expression restored SREBP2 protein expression and steroidogenic responses, highlighting the SCAP-SREBP2 requirement in steroidogenesis. PMID: 27601673
  4. Studies using transgenic mice suggest that astrocyte-derived lipids are necessary for oligodendroglial myelination; oligodendrocyte-specific SCAP inactivation significantly impairs CNS myelination. PMID: 28549068
  5. CYP3A deficiency stimulated SCAP expression via AR (androgen receptor) activation, increasing cholesterogenic gene expression through SREBP2 and raising total prostate cholesterol. PMID: 27137100
  6. SIRT1 gene knockout may worsen cartilage degeneration in osteoarthritis by activating the SREBP2-mediated PI3K/AKT signaling pathway, suggesting a protective role for SIRT1. PMID: 27752896
  7. p75NTR (p75 neurotrophin receptor) activation triggers a hepatocyte signaling pathway (p38 MAPK and caspase-3) mediating SREBP2 activation, potentially regulating LDLRs (low-density lipoprotein receptors) and lipid uptake after injury or inflammation. PMID: 26984409
  8. The mTORC1/SREBP pathway is a key mechanism by which oncogenic signaling induces de novo lipid synthesis, promoting cancer cell growth and proliferation. PMID: 26028026
  9. SHP (SHP) acts as a global transcriptional partner of SREBP-2 in regulating sterol biosynthetic gene networks, providing a potential mechanism for FGF19's cholesterol-lowering effects. PMID: 26634251
  10. SREBP2 activation was found downstream of ER stress and responsible for intracellular cholesterol accumulation (confirmed using RNAi). PMID: 26184741
  11. ITCH (itchy homolog) modulates SIRT6 and SREBP2, influencing lipid metabolism and atherosclerosis in ApoE null mice. PMID: 25777360
  12. SREBP2-induced miR-92a targets endothelial homeostasis molecules (SIRT1, KLF2, KLF4), leading to NLRP3 inflammasome activation and eNOS inhibition. PMID: 25550450
  13. FGF21's cholesterol-lowering effects are negated by hepatic SREBP-2 expression. PMID: 25794851
  14. Leishmania utilizes macrophage cholesterol-dependent SREBP2 to facilitate entry and survival. PMID: 25218172
  15. FXR (farnesoid X receptor) activation uncouples the expression of nuclear SREBP-2 and miR-33, and their target gene regulation. PMID: 25593129
  16. The cardiac SREBP2/HMG-CoA reductase pathway is upregulated in MMP-2 deficiency. PMID: 25646300
  17. Intestinal SREBP2 activation alone increases plasma cholesterol. PMID: 24465397
  18. Hepatic insulin receptor knockout mice show decreased nuclear SREBP-2, cholesterologenic gene expression, and cholesterol synthesis. PMID: 24516236
  19. SREBP-2 regulation in cholesterol transport occurs through NF-κB activation. PMID: 24360166
  20. PCSK9 (proprotein convertase subtilisin/kexin type 9) induced by hepatic Idol overexpression, via SREBP2/LDLR, might create a vicious cycle in LDLR degradation. PMID: 24675665
  21. Inflammation disrupts LDLr feedback regulation through mTOR pathway activation, increasing mTORC1 activity and upregulating SREBP-2-mediated cholesterol uptake. PMID: 24068000
  22. Sirt6 critically regulates hepatic Srebp2 gene expression and cholesterol homeostasis. PMID: 23881913
  23. A CYP7A1/SREBP2/miR-33a axis regulates hepatic cholesterol, bile acid, and fatty acid synthesis. PMID: 23536474
  24. Atheroprone flow induces endothelial NLRP3 inflammasome through SREBP2 activation. PMID: 23838163
  25. Acetoacetyl-CoA synthetase (a ketone body-utilizing enzyme) is controlled by SREBP-2 and affects serum cholesterol levels. PMID: 22985732
  26. AACS (acetoacetyl-CoA synthetase) is regulated by SREBP-2 and is involved in neuronal development. PMID: 23000407
  27. SREBP-2 and ER stress pathway induction is independent of PPARα activation in Pex2 knockout mice. PMID: 22441164
  28. Endoplasmic reticulum enlargement is independent of SREBP-2 activation. PMID: 22675522
  29. ER stress-induced SREBP-2 activation contributes to renal proximal tubule cell injury by dysregulating lipid homeostasis. PMID: 22573382
  30. The C3112T substitution in Srebf2 is responsible for the Lens opacity 13 phenotype. PMID: 21858719
  31. Linalool reduces 3-hydroxy-3-methylglutaryl CoA reductase expression via SREBP-2 and ubiquitin-dependent mechanisms. PMID: 21944868
  32. SREBP-2 directly activates autophagy genes during cell-sterol depletion, which induces both autophagy and nuclear SREBP-2 levels. PMID: 21459322
  33. In insulin-deficient diabetic mice, reduced SREBP-2 and downstream gene expression in the brain reduces brain cholesterol synthesis and synaptosomal cholesterol content. PMID: 21109190
  34. Adipocyte hypertrophy and chronic inflammation are equally important in inducing chemerin synthesis. PMID: 21084441
  35. Activated SREBP-2 interacts with PGC-1α (peroxisome proliferator-activated receptor gamma coactivator) in livers at reduced cholesterol intake. PMID: 20926756
  36. miR-33, encoded within an SREBP2 intron, inhibits cholesterol export and fatty acid oxidation. PMID: 20732877
  37. Inflammation causes hepatic lipid accumulation by disrupting SREBP-2 and LDLr expression. PMID: 20510003
  38. miR-33 is encoded within SREBP-2 and both mRNAs are co-expressed. PMID: 20566875
  39. miR-33a/b, within SREBP genes' introns, represses ABCA1 (a regulator of HDL synthesis and reverse cholesterol transport), indicating miR-33 acts with SREBP genes to control cholesterol homeostasis. PMID: 20466882
  40. A novel SREBP2 isoform, enriched in spermatogenic cells, is expressed stage-dependently and isn't subject to sterol feedback control. PMID: 12446768
  41. Thyroid hormone regulation and cholesterol metabolism are connected through SREBP-2. PMID: 12829694
  42. SREBP-2 interacts with HNF-4 (hepatocyte nuclear factor-4) to enhance sterol isomerase gene expression. PMID: 12855700
  43. Lanosterol metabolism and SREBP2 expression in male germ cell maturation. PMID: 12943732
  44. SREBP2gc is a trans-activator of male germ cell-specific gene expression. PMID: 15572673
  45. The SREBP2 protein is relatively specific to cholesterol synthesis. PMID: 15589694
  46. Role in regulating mevalonate kinase and cob(I)alamin adenosyltransferase. PMID: 17300749
  47. Hepatic Pcsk9 mRNA levels in refed mice correlate with Srebp-2 regulation via changes in nuclear Srebp-2. PMID: 17921436
  48. SREBP2 regulates gut peptide secretion through intestinal bitter taste receptor signaling. PMID: 18846256
  49. Srd5a2 induction through SREBP-2 explains why statin therapy, while effective in reducing cholesterol, doesn't compromise androgen production. PMID: 19500568
  50. Prion-dependent increased Srebp2 activity upregulates cholesterogenic genes, elevating cellular cholesterol. PMID: 19748890
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 2]: Nucleus.

Q&A

What is the structural organization of mouse SREBF2 and how does it function in cellular metabolism?

SREBF2 belongs to the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. It is initially synthesized as a large precursor protein anchored to the endoplasmic reticulum membrane. The N-terminal segment contains the bHLH-Zip domain responsible for DNA binding and dimerization. Unlike SREBF1 which primarily regulates fatty acid metabolism, SREBF2 predominantly controls cholesterol metabolism by activating genes involved in cholesterol biosynthesis and uptake when cellular sterol levels are low .

How is SREBF2 processed and activated in response to cellular signals?

SREBF2 activation follows a tightly regulated process. The precursor protein resides in the ER membrane bound to SREBF cleavage activation protein (SCAP), which in turn binds to insulin-induced gene 1/2 (INSIG1/2). When cellular sterol levels decrease, INSIG1/2 dissociates from SCAP, allowing the SREBF2-SCAP complex to translocate to the Golgi apparatus. There, SREBF2 undergoes sequential proteolytic cleavage by site-1 protease (S1P) and site-2 protease (S2P), encoded by MBTPS1 and MBTPS2, respectively. This processing liberates the transcriptionally active N-terminal domain, which then enters the nucleus to regulate gene expression .

What evidence supports the dimeric state of SREBF2 and its importance for function?

Experimental evidence indicates that active SREBF2 exists as a stable dimer in solution. Research has demonstrated that substituting leucine residues with alanine in the leucine zipper motif disrupts this dimerization. Notably, dimerization-deficient mutants fail to enter the nucleus both in vivo and in vitro, indicating that dimerization is a prerequisite for nuclear import. Chemical cross-linking experiments have revealed that the import-active complex consists of a dimeric form of SREBF2 bound to importin β, further supporting the critical role of dimerization in SREBF2 function .

What distinguishes the nuclear import pathway of SREBF2 from classical nuclear import mechanisms?

SREBF2 utilizes a distinct nuclear transport pathway that differs significantly from the classical importin α/β-dependent mechanism. Unlike most nuclear proteins that require importin α as an adapter, SREBF2 binds directly to importin β through its HLH-Zip motif, which contains a novel type of nuclear localization signal. This direct interaction occurs in the absence of importin α. The SREBF2-importin β complex is regulated by Ran, as Ran-GTP (but not Ran-GDP) causes dissociation of this complex. In permeabilized cell systems, nuclear import of SREBF2 can be reconstituted using only importin β together with Ran and its interacting protein p10/NTF2 .

How do experimental approaches demonstrate the importin β-mediated nuclear import of SREBF2?

Researchers have employed multiple complementary approaches to characterize the nuclear import mechanism of SREBF2. When injected into cell cytoplasm, the mature form of SREBF2 is actively transported into the nucleus. Binding assays have shown that SREBF2 interacts directly with importin β in the absence of importin α. The regulatory role of Ran has been demonstrated by showing that G19VRan-GTP (a mutant form) inhibits SREBF2 nuclear import in living cells. In vitro transport systems using permeabilized cells have confirmed that SREBF2 nuclear import requires only importin β, Ran, and p10/NTF2, further supporting this distinct transport pathway .

What structural features of importin β enable direct binding to SREBF2?

The SREBF2 binding domain of importin β corresponds to an overlapping but not identical region for importin α binding. This structural arrangement explains how importin β can recognize the dimeric HLH-Zip domain directly without requiring importin α as an adapter. Solution binding assays using chemical cross-linking of wild-type or mutated SREBF2 with importin β have revealed that the import-active complex appears to be composed of a dimeric form of SREBF2 and importin β. These findings indicate that the specific conformation of dimeric SREBF2 presents binding surfaces that are directly recognized by importin β .

What expression systems are optimal for producing functional recombinant mouse SREBF2?

Based on published research protocols, bacterial expression systems utilizing vectors such as pRSETA and pGEX have successfully produced recombinant SREBF2 fragments. For full-length SREBF2 constructs, the vector selection should account for proper folding of the bHLH-Zip domain and potential membrane association of the precursor form. His-tagged and GST-tagged constructs have been effectively used for purification and interaction studies. When designing expression vectors, researchers should consider whether they need the full-length precursor or just the transcriptionally active N-terminal domain depending on their experimental objectives .

What methodological approaches can be used to study SREBF2 dimerization?

Several complementary techniques have been employed to investigate SREBF2 dimerization. Chemical cross-linking assays can detect dimeric forms by incubating purified SREBF2 with cross-linkers followed by SDS-PAGE analysis. Site-directed mutagenesis of leucine residues in the leucine zipper motif can generate dimerization-deficient controls. Solution binding assays using different concentrations of purified wild-type or mutant Flag-SREBF2 incubated with GST-importin β can assess how dimerization affects protein-protein interactions. Researchers typically use concentrations ranging from 25 nM to 1.6 μM of purified Flag-SREBF2 or Flag-SREBF2/L1.2.3A (leucine zipper mutant) with 1 μM GST-importin β in binding buffer (20 mM HEPES-KOH, pH 7.3) containing BSA (10 mg/ml) .

What considerations are important when designing SREBF2 truncation constructs for domain mapping?

When mapping functional domains of SREBF2, strategic design of truncation constructs is essential. Previous studies have generated various truncated versions including SREBP-2(1–403), SREBP-2(1–370), SREBP-2(1–317), and SREBP-2(343–403) to identify critical regions for different functions. When designing such constructs, researchers should ensure that the HLH-Zip domain remains intact if studying dimerization or DNA binding. For visualization studies, GFP-fusion proteins have proven effective. Expression vectors such as pRSETA GFP-SREBP2 (containing His-tagged SREBP-2 fused with GFP at the N-terminus) have been successfully used for localization and trafficking studies. Each truncated construct should be validated for proper folding and function using appropriate assays .

How does SREBF2 function contribute to oligodendrocyte survival and myelination?

Research has revealed an important connection between SREBF2 and neurological function, particularly in oligodendrocytes. Studies in mice with oligodendroglial TDP-43 deletion have shown a progressive reduction in SREBF2 expression and its downstream targets involved in cholesterol biosynthesis. This reduction correlates with progressive myelin deficits in the spinal cord, highlighting the critical role of SREBF2-regulated cholesterol biosynthesis in myelin formation and maintenance. RNA fluorescence in situ hybridization combined with immunofluorescence has quantitatively demonstrated reduced SREBF2 mRNA levels specifically in oligodendrocytes of these mice, with a progressive decline from P21 (35% decrease) to P60 (65% decrease) .

What is the relationship between TDP-43 and SREBF2 regulatory networks?

TDP-43, a major disease protein implicated in neurodegenerative disorders, mediates SREBF2-dependent gene expression required for oligodendrocyte survival and function. In mice with oligodendroglial TDP-43 deletion, analysis of differentially expressed genes revealed dysregulated pathways centering on cholesterol biosynthesis, sterol biosynthesis, and SREBF regulation. Only SREBF2 and INSIG1 showed progressive reduction between P21 and P60, while the expression of other components (SCAP, MBTPS1, MBTPS2, and INSIG2) remained unchanged. Interestingly, SREBF1 expression was elevated at both time points, suggesting that TDP-43 deletion selectively impacts the SREBF2 pathway. This selective targeting indicates a specific regulatory relationship between TDP-43 and SREBF2-mediated cholesterol metabolism in oligodendrocytes .

How can recombinant SREBF2 be utilized to study cholesterol homeostasis disorders?

Recombinant SREBF2 provides a valuable tool for investigating disorders of cholesterol homeostasis. By reconstituting the SREBF2 pathway in vitro using purified components, researchers can examine how mutations or modifications affect SREBF2 processing, dimerization, and transcriptional activity. Binding assays with recombinant SREBF2 can identify potential therapeutic compounds that modulate its activity. Additionally, expressing wild-type or mutant SREBF2 in cellular models of cholesterol-related disorders can help elucidate pathogenic mechanisms and test intervention strategies. When designing such experiments, researchers should carefully consider whether to use the full-length precursor or the processed N-terminal domain, depending on the specific aspect of SREBF2 function under investigation .

What imaging techniques are most effective for studying SREBF2 trafficking and localization?

Multiple imaging approaches have been validated for studying SREBF2 dynamics. Immunofluorescence using specific anti-SREBF2 antibodies can visualize endogenous protein in fixed cells, as demonstrated with the anti-SREBF2/SREBF2 antibody (A01678-2) in MCF-7 cells. For live-cell imaging, GFP-tagged SREBF2 constructs enable real-time visualization of trafficking from the ER to nucleus. Combined RNA-FISH with immunofluorescence techniques allow simultaneous detection of SREBF2 mRNA and protein. This approach has been used to reconstruct 3D images of individual oligodendrocytes and quantify FISH signals for SREBF2, providing critical insights into cell-specific expression patterns. For optimal results, enzyme antigen retrieval (using reagents like IHC enzyme antigen retrieval reagent AR0022) may be necessary for certain applications .

What flow cytometry protocols have been validated for SREBF2 detection in cellular models?

Flow cytometry has been successfully employed to analyze SREBF2 expression in various cell types. Established protocols include fixing cells with 4% paraformaldehyde and permeabilizing them with appropriate buffer prior to antibody staining. For instance, K562 cells have been analyzed using anti-SREBF2 antibody (A01678-2) at a concentration of 1 μg per 10^6 cells, followed by detection with DyLight®488 conjugated secondary antibody. To ensure specificity, appropriate controls should be included: isotype control antibody (such as rabbit IgG at 1 μg/10^6 cells) and unlabelled samples without primary and secondary antibodies. This approach allows quantitative assessment of SREBF2 expression levels across cell populations and can be particularly valuable for evaluating the effects of experimental manipulations on SREBF2 expression .

How can protein-protein interaction networks of SREBF2 be comprehensively mapped?

Mapping the interaction network of SREBF2 requires a multi-faceted approach. In vitro binding assays using purified proteins can identify direct interactions, as demonstrated with SREBF2 and importin β. Typically, purified Flag-SREBF2 (at concentrations ranging from 25 nM to 1.6 μM) is incubated with GST-tagged potential binding partners (approximately 1 μM) in appropriate buffer conditions. Co-immunoprecipitation experiments can capture physiologically relevant interactions in cellular contexts. Additionally, proximity labeling approaches such as BioID or APEX2 can identify proteins in close proximity to SREBF2 in living cells. When analyzing novel interactions, researchers should consider whether dimerization of SREBF2 is required, as some binding partners might specifically recognize the dimeric conformation. Comparing wild-type SREBF2 with dimerization-deficient mutants (leucine zipper mutants) can help identify dimerization-dependent interactions .

What antibody specifications are optimal for detecting mouse SREBF2 in different applications?

Table 1: SREBF2 Antibody Specifications and Applications

AntibodyHostReactivityApplicationsWorking DilutionSpecial Considerations
Anti-SREBP2/SREBF2 Antibody Picoband® (A01678-2)RabbitHuman, Mouse, RatELISA, Flow Cytometry, IF, ICC, WBWB: 1:500-1:2000; IF/ICC: 5 μg/mL; Flow Cytometry: 1 μg/10^6 cellsHigh-quality antibody ensuring superior quality, high affinity, and strong signals with minimal background in applications
Secondary antibody (for A01678-2)GoatRabbit IgGIF, Flow CytometryIF: 1:100; Flow: 5-10 μg/10^6 cellsDyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) recommended

What expression construct designs have been validated for producing functional recombinant SREBF2?

Table 2: Validated SREBF2 Expression Constructs

ConstructVectorTagFragmentApplicationSpecial Considerations
pGEX FL-SREBP2pGEXGSTFull-lengthProtein purification, binding assaysSuitable for bacterial expression
pRSETA SREBP-2(1-370)pRSETAHisaa 1-370Domain mappingN-terminal fragment containing bHLH-Zip domain
pRSETA GFP-SREBP2pRSETAHis-GFPFull-lengthLocalization, traffickingGFP fusion at N-terminus
pRSETA GFP-SREBP2 truncationspRSETAHis-GFPVarious (1-403, 1-370, 1-317, 343-403)Domain mappingSeries of truncations for functional analysis

What experimental conditions are optimal for studying SREBF2-importin β interactions?

Table 3: Optimized Conditions for SREBF2-Importin β Binding Assays

ParameterSpecificationNotes
Buffer composition20 mM HEPES-KOH (pH 7.3), BSA (10 mg/ml)Standard binding buffer for in vitro assays
Protein concentrationsSREBF2: 25 nM - 1.6 μM; Importin β: ~1 μMRange used in published studies
Incubation conditionsRoom temperature, variable timeOptimize based on specific assay requirements
Detection methodChemical cross-linking followed by SDS-PAGEEffective for visualizing protein complexes
ControlsDimerization-deficient SREBF2 (L1.2.3A), GST aloneEssential for specificity verification
Ran effect testingAdd Ran-GTP vs. Ran-GDPRan-GTP should dissociate the complex

What are the most promising approaches for targeting SREBF2 in neurological disorders?

Based on the emerging connection between SREBF2 and neurological function, particularly in oligodendrocytes, several research directions appear promising. Developing compounds that modulate SREBF2 processing or activation could potentially address myelin deficits in demyelinating disorders. Gene therapy approaches to restore proper SREBF2 expression in TDP-43-related conditions might help maintain oligodendrocyte function. Additionally, investigating the "horizontal cholesterol transfer" from astrocytes to oligodendrocytes as a complementary pathway could reveal compensatory mechanisms. Recombinant SREBF2 can serve as a valuable tool for high-throughput screening of compounds that affect its dimerization, nuclear import, or transcriptional activity, potentially leading to therapeutic interventions for conditions involving myelin deficits .

How might advanced structural studies of SREBF2 inform therapeutic development?

Structural characterization of the SREBF2 bHLH-Zip domain and its interaction with importin β could provide crucial insights for drug design. Determining the crystal structure of the SREBF2-importin β complex would reveal the precise binding interface and potential targets for small molecule intervention. Understanding the structural basis of SREBF2 dimerization could enable the development of compounds that either promote or inhibit this process, depending on the therapeutic goal. Furthermore, structural studies of the SREBF2-DNA complex could identify specific contacts that might be targeted to modulate transcriptional activity selectively. These approaches could ultimately lead to precision therapeutics for disorders involving dysregulated cholesterol metabolism or myelin deficits .

What is the potential for developing recombinant SREBF2 as a research tool for studying metabolic disorders?

Recombinant SREBF2 has significant potential as a research tool for metabolic disorders. Purified SREBF2 can be used in reconstituted systems to study the mechanistic details of cholesterol sensing and gene regulation. Domain-specific constructs can help identify regions critical for various functions and potential drug targets. Cell-permeable versions of recombinant SREBF2 might serve as molecular probes for cellular cholesterol metabolism. Additionally, engineered variants with altered activity or regulation could provide insights into pathological conditions. When developing such tools, researchers should consider whether to use the full-length precursor or the processed N-terminal domain, depending on the specific aspect of SREBF2 function under investigation, and carefully validate the activity of their recombinant proteins through appropriate functional assays .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.