Recombinant Mouse Steryl-sulfatase (Sts)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted based on your needs.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Sts; Steryl-sulfatase; Arylsulfatase C; ASC; Steroid sulfatase; Steryl-sulfate sulfohydrolase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-624
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Sts
Target Protein Sequence
ADPAPAGPAPRPPNFLLIMADDLGIGDLGCYGNKTLRTPHLDRLAREGVKLTQHLAAAPL CTPSRAAFLTGRYPPRSGMAAHGRVGVYLFTASSGGLPPSEVTMARLLKGRGYATALIGK WHLGLSCRGATDFCHHPLRHGFDRFLGVPTTNLRDCRPGAGTVFGPALRVFAAGPLAALG ASLAAMAAARWAGLARVPGWALAGTAAAMLAVGGPRSASCLGFRPANCFLMDDLAVAQRP TDYGGLTRRLADEAALFLRRNRARPFLLFLSFLHVHTAHFADPGFAGRSLHGAYGDSVEE MDWGVGRVLAALDELGLARETLVYFTSDHGAHVEELGPRGERMGGSNGVFRGGKGNNWEG GVRVPCLVRWPRELSPGRVVAEPTSLMDVFPTVARLAGAELPGDRVIDGRDLMPLLRGDA QRSEHEFLFHYCNAYLQAVRWHNGSAVWKAFYFTPNFAPAGANGCFSTHVCLCAGPAHVT AHDPPLLFDLTRDPGERRPLTPEAEPRHREVLDAIDAAARAHRARLRPAPDQLAPRHLMW KPWLQLWGGGGAGGGAGAQDDSGHAHGDGSHAHDDPGHAQDRGDDDAHYGGHATTRTQAT PR
Uniprot No.

Target Background

Function
This recombinant mouse Steryl-sulfatase (STS) catalyzes the conversion of sulfated steroid precursors, such as dehydroepiandrosterone sulfate (DHEA-S) and estrone sulfate, to their free steroid forms.
Gene References Into Functions

Functional Studies of Steroid Sulfatase (STS):

  1. Hepatic STS overexpression improved metabolic function in obese and type 2 diabetic mouse models via sex-specific mechanisms. (PMID: 24497646) [Link]
  2. Inactivating mutations and functional variants within STS may influence ADHD vulnerability and endophenotypes by modulating the serotonergic system. (PMID: 22189290) [Link]
  3. STS may influence core and associated ADHD behavioral endophenotypes through developmental and ongoing mechanisms. (PMID: 21723668) [Link]
  4. Analysis of brain pathways mediating the pro-aggressive effects of the STS gene. (PMID: 20155394) [Link]
  5. STS variation may be particularly associated with the inattentive subtype of ADHD. (PMID: 19251250) [Link]
Database Links

KEGG: mmu:20905

UniGene: Mm.423011

Protein Families
Sulfatase family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=The sequence shows several membrane-spanning domains that could serve to anchor the protein in the microsomal membrane.

Q&A

Basic Research Questions

  • What is Mouse Steryl-sulfatase (Sts) and how does it differ structurally from human STS?

Mouse Steryl-sulfatase (Sts) is an important enzyme in steroid metabolism that catalyzes the hydrolysis of steroid sulfates, converting sulfated steroid precursors to their free forms. Structurally, the mouse Sts shows significant divergence from its human counterpart, with only 63% sequence similarity at the cDNA level, while showing 75% similarity with rat Sts cDNA . This divergence explains why early attempts to clone the mouse Sts gene using human reagents (STS cDNA and anti-STS antibodies) were unsuccessful .

The protein has a predicted molecular weight of approximately 65 kDa, as confirmed by Western blot analysis . Despite structural differences, both mouse and human enzymes share conserved catalytic domains typical of the sulfatase family, particularly in regions responsible for substrate binding and hydrolysis.

  • What is the genomic organization and chromosomal location of mouse Sts?

Unlike human STS which is located on the X chromosome at Xp22.3 proximal to the pseudoautosomal region (PAR), the mouse Sts gene is located within the pseudoautosomal region of both the X and Y chromosomes . This unique genomic organization in mice results in:

  • Functional Sts genes present on both sex chromosomes

  • Physical mapping to the distal end of mouse sex chromosomes

  • Location distal to the 'obligatory' cross-over in male meiosis

Backcross studies have shown that Sts is linked to the mutation sex reversed (Sxr), with only a single recombinant separating Sts and Sxr found out of 103 male meioses analyzed . This suggests that the distance between Sts and the telomere of the Y chromosome is approximately 100-200 kb in length .

  • What expression systems are optimal for producing recombinant mouse Sts?

Several expression systems have been successfully used for producing recombinant mouse Sts:

Expression SystemAdvantagesConsiderationsReference
COS-7 cellsGood for transient expression, maintains mammalian post-translational modificationsGrows at 37°C, though mouse Sts is active at 28°C
A9 cellsUseful for functional studies (STS-negative)Successfully shown to restore STS enzymatic activity when transfected with mouse Sts cDNA
E. coliGood for producing immunogensMay lack proper folding or post-translational modifications

For optimal expression of enzymatically active mouse Sts, mammalian expression systems are recommended due to their ability to properly fold the protein and perform necessary post-translational modifications. Transfection with the full-length 2.3-kb mouse Sts cDNA into STS(-) A9 cells has been demonstrated to successfully restore enzymatic activity .

  • What are the key enzymatic properties of recombinant mouse Sts?

Recombinant mouse Sts exhibits specific enzymatic characteristics:

  • Substrate preference: Similar to human STS, mouse Sts is most active in catalyzing the hydrolysis of estrone-sulfate and estradiol-sulfate among various steroid sulfates

  • Temperature sensitivity: While active at the physiological mouse temperature of 28°C, the enzyme shows higher activity at 37°C with similar Km values at both temperatures

  • Effects of divalent cations: Mouse Sts activity is stimulated by Ca²⁺, Mg²⁺, and Mn²⁺, and inhibited by Zn²⁺ and Fe²⁺, similar to human STS

  • Inhibitor sensitivity: Known mammalian steroid sulfatase inhibitors such as EMATE and STX64 effectively inhibit mouse Sts activity

Kinetic analyses reveal that while Km values of mouse Sts and human STS differ with respective substrates, their catalytic efficiency (Vmax/Km) is comparable for most substrates, with the exception of DHEA-sulfate, with which mouse Sts appears less efficient .

  • What methods are available for detecting and measuring Sts activity in mouse tissues?

Several validated methods exist for detecting and measuring Sts activity:

MethodDescriptionAdvantagesApplicationReference
Radiometric assayUses [³⁵S]-labeled steroid sulfates as substrateHigh sensitivity, quantitativeEnzymatic activity measurements
HPLCSeparation of desulfated steroidsPrecise quantificationInhibition studies
Western blotDetection using anti-STS antibodiesDetects protein expressionTissue expression studies
ImmunohistochemistryTissue localization with antibodiesVisual localization in tissueExpression pattern studies
Flow cytometryCell-based detectionSingle-cell analysis capabilityCellular expression studies

For Western blot applications, commercial antibodies like anti-Steroid sulfatase Picoband antibody have been validated for mouse testis and placenta tissue lysates with a predicted band size of 65 kDa .

Advanced Research Questions

  • What are the differences in substrate specificity between mouse Sts and human STS?

Comparative enzymatic studies have revealed both similarities and differences in substrate specificity between mouse and human enzymes:

SubstrateMouse Sts EfficiencyHuman STS EfficiencyNotesReference
Estrone sulfate (E₁S)HighHighPrimary substrate for both enzymes
Estradiol sulfate (E₂S)HighHighEfficiently processed by both
DHEA sulfateLowerHigherMouse Sts less efficient
Cholesterol sulfatePresentPresentPhysiologically relevant in skin
Pregnenolone sulfatePresentPresentNeurosteroid precursor

The differences in kinetic parameters (Km values) for various substrates suggest subtle structural differences in the substrate binding sites between the two enzymes. These variations may reflect evolutionary adaptations to species-specific steroid metabolism requirements or differences in physiological roles .

  • How do inhibitors affect mouse Sts compared to human STS, and what are the implications for translational research?

Various inhibitors show differential effects on mouse Sts versus human STS:

InhibitorEffect on Mouse StsEffect on Human STSTranslational ImplicationsReference
EMATEPotent inhibitionPotent inhibition but estrogenicLimited clinical utility due to estrogenicity
STX64 (667 COUMATE)Effective inhibitionEffective inhibition, non-estrogenicFirst STS inhibitor in clinical trials
KW-2581InhibitoryStrong inhibitionNon-estrogenic despite steroidal structure
STX213Extended duration of inhibitionShorter duration than in mouseSpecies differences in pharmacokinetics

These comparative inhibitor studies are crucial for translational research as:

  • Mouse models may overestimate or underestimate inhibitor efficacy in humans

  • Differences in inhibitor pharmacokinetics between species must be considered when extrapolating to human clinical applications

  • Targeting mouse Sts in cancer models may require different dosing strategies than anticipated for human applications

  • What are the implications of the pseudoautosomal localization of mouse Sts for research models?

The pseudoautosomal localization of mouse Sts on both X and Y chromosomes creates several important implications for research models:

  • Dosage and expression: Unlike the human STS gene, mouse Sts is not dosage compensated and is not subject to X-inactivation . This results in differences in expression levels between XO, XX, and XY mice.

  • Sex differences: The presence of functional Sts genes on both sex chromosomes means that, unlike in humans where STS deficiency predominantly affects males, genetic modifications of Sts in mice may affect both sexes similarly.

  • Recombination studies: The high rate of recombination in the pseudoautosomal region (7-10× higher than normal) means that Sts can serve as a genetic marker for studying recombination mechanisms in this region .

  • Evolutionary comparison: The different chromosomal localization between species provides a model for studying evolutionary changes in sex chromosome organization and pseudoautosomal gene function.

  • Disease modeling limitations: The different genomic organization creates challenges when using mouse models to study human X-linked conditions such as X-linked ichthyosis.

  • How can recombinant mouse Sts be utilized in studying steroid metabolism pathways?

Recombinant mouse Sts serves as a valuable tool for investigating steroid metabolism through multiple applications:

  • Comparative metabolism studies: Examining differences in steroid metabolism between species by comparing enzymatic parameters of recombinant mouse versus human enzymes .

  • Inhibitor development: Screening and evaluating potential STS inhibitors in a controlled system prior to in vivo testing, particularly for cancer therapies targeting steroid-dependent tumors .

  • Steroid regulatory pathway elucidation: Investigating the sulfation/desulfation pathway in concert with steroid sulfotransferases to understand the complete regulatory circuit controlling bioavailable steroids .

  • Structure-function analyses: Site-directed mutagenesis of recombinant mouse Sts can identify critical residues for catalytic activity, substrate binding, and inhibitor interaction.

  • Developmental studies: Examining the role of Sts in physiological processes by correlating enzyme activity with steroid availability during different developmental stages.

  • Tissue-specific metabolism: Comparing recombinant enzyme activity with tissue-derived samples to understand tissue-specific regulation of steroid metabolism .

  • What technical challenges exist in expressing functional mouse Sts in heterologous systems?

Several technical challenges must be addressed when expressing functional mouse Sts:

ChallengeDescriptionPotential SolutionsReference
Transmembrane domainSts is a multi-pass membrane protein localized to the endoplasmic reticulumUse of appropriate detergents or membrane-mimetic systems; expression of soluble catalytic domain
Post-translational modificationsProper folding and modifications required for activityMammalian expression systems preferred over prokaryotic systems
Temperature optimizationMouse Sts shows different activity at different temperaturesExpression at 28°C (mouse physiological) versus 37°C (human physiological)
Purification difficultiesMembrane proteins are challenging to purifyFusion tags; optimization of solubilization conditions
Activity assay sensitivityVarying levels of activity with different substratesRadiometric assays with high sensitivity; multiple substrate testing

Additionally, when designing expression constructs, researchers should consider:

  • Using the full-length 2.3-kb mouse Sts cDNA to ensure all required domains are present

  • Including appropriate cofactors such as Ca²⁺ in buffers to maximize enzymatic activity

  • Testing activity at different temperatures to understand the thermal profile of the enzyme

  • Considering the use of different splice variants (Sts_tv1, Sts_tv2) which may have different properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.