Recombinant Mouse Substance-K receptor (Tacr2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
Tacr2; Tac2r; Substance-K receptor; SKR; NK-2 receptor; NK-2R; Neurokinin A receptor; Tachykinin receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGAHASVTDTNILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILA HERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGSTFCYFQNLFPVTAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAVIWLVALALASPQCFYSTITVDQGATK CVVAWPNDNGGKMLLLYHLVVFVLIYFLPLVVMFAAYSVIGLTLWKRAVPRHQAHGANLR HLQAKKKFVKAMVLVVVTFAICWLPYHLYFILGTFQEDIYYRKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWGTPTEEDRLELTHTPSISRRVNRCHTKETLFMT GDMTHSEATNGQVGGPQDGEPAGP
Uniprot No.

Target Background

Function

This protein is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is coupled to G proteins that activate a phosphatidylinositol-calcium second messenger system. The receptor exhibits the following tachykinin affinity ranking: substance K > neuromedin-K > substance P.

Gene References Into Functions
  1. Tacr2 negatively regulates the expression of neuronal nitric oxide synthase (nNOS) and vasoactive intestinal polypeptide (VIP). Its ablation in mice increased nNOS and VIP expression, enhanced nitric oxide signaling, and altered CREB and NF-κB signaling, ultimately leading to impaired gastric emptying in Tacr2-/- mice. PMID: 28585346
  2. NK2R-dependent neuropeptide signaling regulates antigen-specific T cell responses through dendritic cell (DC) activation. PMID: 22474018
  3. Tachykinin NK2 receptor genes are expressed in mouse uterine cells, oocytes, ovaries, and embryos, suggesting a potential role in female reproductive function. PMID: 12773411
  4. In the mouse colon, both NK1 and NK2 receptors are activated junctionally by endogenous tachykinins, resulting in an additive response. NK2 receptors appear to be exclusively located on smooth muscle cells. PMID: 17597603
Database Links

KEGG: mmu:21337

STRING: 10090.ENSMUSP00000020278

UniGene: Mm.8054

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is mouse Substance-K receptor (Tacr2) and how does it compare to human TACR2?

Mouse Substance-K receptor, encoded by the Tacr2 gene, belongs to the tachykinin receptor family that functions as receptors for neurokinin peptides. Like its human counterpart, mouse Tacr2 is a G protein-coupled receptor characterized by seven hydrophobic transmembrane domains . The receptor specifically binds neurokinin A (also called substance K) and activates a phosphatidylinositol-calcium second messenger system . While both human and mouse receptors share similar structural features, their amino acid sequences show species-specific variations that can affect ligand binding properties and downstream signaling dynamics. In experimental contexts, these differences must be considered when translating findings between mouse models and human applications.

The receptor structure includes:

  • 7 hydrophobic transmembrane regions

  • G-protein coupling domains

  • Extracellular ligand binding regions

  • Intracellular signaling interfaces

What are the primary functions of Tacr2 in mouse physiological systems?

In mice, Tacr2 mediates multiple physiological processes through its interaction with neurokinin A. The receptor plays roles in:

  • Neurological function: Mediates neurotransmission in specific neural circuits

  • Smooth muscle contraction: Particularly in the respiratory and gastrointestinal tracts

  • Immune modulation: Participates in neurogenic inflammation

  • Pain perception: Contributes to nociceptive signaling pathways

These functions are regulated through G-protein mediated signaling cascades that primarily activate a phosphatidylinositol-calcium second messenger system . Understanding these physiological roles informs experimental design and interpretation of results when using mouse models to study tachykinin signaling pathways.

How is Tacr2 expressed in different mouse tissues throughout development?

Tacr2 expression follows temporal and spatial patterns that reflect its diverse physiological functions. During mouse development, expression begins during embryogenesis and continues with tissue-specific regulation into adulthood. The receptor shows notable expression in:

  • Central nervous system: Various brain regions including hypothalamus and amygdala

  • Peripheral nervous system: Sensory neurons and enteric nervous system

  • Smooth muscle tissues: Respiratory and gastrointestinal tracts

  • Immune cells: Specific leukocyte populations

Expression patterns can be influenced by age, sex hormones, and physiological state . When designing developmental studies, researchers should account for these variables through appropriate controls and age-matched comparisons. Methodologically, quantitative PCR, in situ hybridization, and immunohistochemistry with specific antibodies (such as those reactive to the 44 kDa protein) provide complementary approaches to characterize expression patterns .

What expression systems are most effective for producing functional recombinant mouse Tacr2?

The optimal expression system depends on experimental objectives and downstream applications. Common systems include:

Expression SystemAdvantagesLimitationsBest Applications
HEK293 cellsHigh transfection efficiency, mammalian post-translational modificationsLower protein yield than specialized systemsFunctional studies, signaling assays
CHO cellsStable expression, scalable productionMore complex culture requirementsLong-term studies, stable cell line generation
Baculovirus/insect cellsHigh protein yield, eukaryotic processingDifferent glycosylation patternsStructural studies, protein purification
E. coliRapid expression, high yieldLacks mammalian post-translational modificationsPeptide domains, antibody generation

For functional studies, mammalian systems like HEK293 and CHO cells generally provide the most physiologically relevant expression of mouse Tacr2. These systems support proper folding, membrane insertion, and post-translational modifications essential for receptor function . When establishing expression systems, verification of protein expression via Western blot analysis using specific antibodies that detect the expected 44 kDa protein is recommended .

What methodologies are available for measuring mouse Tacr2 activation and signaling?

Multiple complementary approaches can assess Tacr2 functionality:

  • G-protein activation assays:

    • GTPγS binding assays to measure G-protein coupling

    • Calcium mobilization assays using fluorescent indicators

    • Inositol phosphate accumulation assays

  • β-arrestin recruitment:

    • GPCR Tango assay for measuring β-arrestin recruitment

    • Bioluminescence resonance energy transfer (BRET) assays

  • Receptor internalization:

    • Fluorescently-tagged receptor tracking

    • Cell surface biotinylation and internalization quantification

  • Downstream signaling:

    • Phosphorylation of ERK1/2 and other kinases

    • Gene expression changes using quantitative PCR or RNA-sequencing

When designing these experiments, appropriate positive controls are essential. The selective Tacr2 agonist GR-64349 (EC₅₀ 3.7nM) can serve as a reliable positive control for receptor activation . For antagonist studies, selective compounds like MEN-10376 provide useful tools for validation experiments .

How can specificity of Tacr2 antibodies be validated for research applications?

Validating antibody specificity is critical for reliable experimental results. A comprehensive validation strategy includes:

  • Western blot analysis:

    • Positive controls: Cell lines with confirmed Tacr2 expression (e.g., transfected HeLa or PC-3 cells)

    • Negative controls: Knockout tissues or siRNA-treated samples

    • Expected molecular weight verification (44 kDa for mouse Tacr2)

  • Immunohistochemistry validation:

    • Comparison with in situ hybridization patterns

    • Peptide competition assays

    • Testing in multiple tissue types with known expression patterns

  • Functional validation:

    • Immunoprecipitation followed by mass spectrometry

    • Knockdown/knockout verification

    • Cross-reactivity assessment with related receptors (NK1, NK3)

For Western blot applications, recommended dilutions typically range from 1:500-1:1000, though optimization for specific experimental conditions is advisable . Storage of antibodies at -20°C in appropriate buffer solutions (e.g., PBS with 0.02% sodium azide and 50% glycerol, pH 7.3) maintains stability for approximately one year .

How do selective agonists and antagonists differentially affect mouse Tacr2 compared to other tachykinin receptors?

Selective pharmacological tools enable precise manipulation of Tacr2 signaling:

CompoundTypeSelectivityPotencyChemical NatureResearch Applications
GR-64349AgonistTacr2-selectiveEC₅₀ 3.7nM7-amino acid polypeptideReceptor activation studies, signaling pathway analysis
MEN-10376AntagonistTacr2-selectiveHigh potency7-amino acid polypeptideReceptor blocking studies, physiological function assessment
GR-159897AntagonistTacr2-selectiveModerate potencySmall moleculeIn vivo applications, behavioral studies
SaredutantAntagonistTacr2-selectiveMixed efficacySmall moleculePreviously investigated for anxiety/depression
IbodutantAntagonistTacr2-selectiveHigh potencySmall moleculePreviously investigated for IBS treatment

When designing experiments with these compounds, considerations include:

  • Species differences in binding affinities between mouse and human receptors

  • Off-target effects at higher concentrations

  • Pharmacokinetic properties for in vivo applications

  • Solution stability and appropriate vehicle selection

For functional studies, dose-response curves should be established as potency can vary between expression systems and experimental conditions. Controls including selective ligands for other tachykinin receptors (NK1, NK3) help confirm specificity .

What approaches can resolve challenges in structural characterization of mouse Tacr2?

Structural studies of Tacr2 face significant challenges due to its membrane-embedded nature. Successful approaches include:

  • Cryo-electron microscopy:

    • Requires purification in appropriate detergents or nanodiscs

    • May benefit from stabilizing mutations or fusion partners

    • Often requires antibody fragments to increase particle size

  • X-ray crystallography:

    • Typically requires thermostabilizing mutations

    • Lipidic cubic phase crystallization

    • Co-crystallization with high-affinity ligands or antibody fragments

  • Molecular dynamics simulations:

    • Homology modeling based on related GPCR structures

    • Simulation of ligand docking and binding pocket interactions

    • Prediction of conformational changes during activation

  • Hydrogen-deuterium exchange mass spectrometry:

    • Analysis of dynamic regions and ligand-induced conformational changes

    • Identification of allosteric binding sites

    • Examination of G-protein coupling interfaces

Each approach provides complementary structural information. Integration of multiple techniques offers the most comprehensive understanding of receptor structure-function relationships.

How can mouse models with modified Tacr2 be developed to study physiological functions?

Creating mouse models with altered Tacr2 expression provides valuable insights into receptor function. Approaches include:

  • Conventional knockout strategies:

    • Homologous recombination to delete functional gene regions

    • Careful phenotyping across multiple physiological systems

    • Consideration of developmental compensation effects

  • Conditional knockout approaches:

    • Cre-loxP system for tissue-specific deletion

    • Tamoxifen-inducible systems for temporal control

    • Viral vector delivery for regional specificity

  • Knockin strategies:

    • Introduction of reporter genes (GFP, luciferase) for expression monitoring

    • Humanized mouse models replacing mouse Tacr2 with human TACR2

    • Point mutations to study specific functional domains

  • CRISPR/Cas9 genome editing:

    • Precise modification of specific amino acids

    • Introduction of clinically relevant mutations

    • Multiplexed editing of multiple tachykinin receptors

When developing these models, characterization should include verification of genetic modifications, expression analysis, and comprehensive phenotyping. Behavioral tests, physiological assessments, and ex vivo tissue preparations provide complementary functional readouts.

What factors affect the detection of mouse Tacr2 in Western blot applications?

Reliable detection of mouse Tacr2 by Western blot requires addressing several technical considerations:

  • Sample preparation challenges:

    • Membrane protein solubilization requires appropriate detergents

    • Heat-induced aggregation can occur with membrane proteins

    • Protein degradation during sample processing

  • Electrophoresis and transfer considerations:

    • Optimal gel percentage (typically 10-12% for 44 kDa proteins)

    • Transfer efficiency monitoring for membrane proteins

    • Blocking optimization to reduce background

  • Antibody selection factors:

    • Validation for mouse Tacr2 specificity

    • Appropriate dilution optimization (typically 1:500-1:1000)

    • Incubation conditions and washing stringency

  • Signal detection optimization:

    • Selection of appropriate detection method (chemiluminescence vs. fluorescence)

    • Exposure time optimization

    • Image analysis approaches for quantification

To troubleshoot inconsistent results, systematic evaluation of each step in the protocol is recommended. Positive controls such as transfected HeLa or PC-3 cells expressing Tacr2 can help validate detection methods .

How can specificity challenges in mouse Tacr2 functional assays be addressed?

Ensuring specificity in functional assays requires careful experimental design:

  • Pharmacological approach:

    • Use multiple structurally distinct selective agonists (e.g., GR-64349)

    • Confirm competitive inhibition with selective antagonists (e.g., MEN-10376)

    • Establish dose-response relationships across concentration ranges

  • Genetic validation:

    • Comparison between wild-type and knockout/knockdown systems

    • Rescue experiments with recombinant expression

    • Mutational analysis of key binding residues

  • Signal pathway verification:

    • Confirm expected G-protein coupling through specific inhibitors

    • Validate calcium signaling with alternate measurement techniques

    • Assess β-arrestin recruitment specificity

  • Cross-receptor selectivity:

    • Test related tachykinin receptors (NK1, NK3) in parallel

    • Use selective ligands for each receptor subtype

    • Consider potential receptor heterodimers in native systems

Careful selection of appropriate controls and validation across multiple experimental approaches provides the highest confidence in specificity of observed effects.

What strategies can overcome challenges in generating stable cell lines expressing mouse Tacr2?

Stable expression of GPCRs like Tacr2 can be challenging due to potential cytotoxicity and expression instability. Effective approaches include:

  • Expression vector optimization:

    • Inducible promoter systems to control expression levels

    • Codon optimization for improved translation efficiency

    • Inclusion of appropriate signaling sequences for membrane targeting

  • Selection strategy refinement:

    • Dual selection markers for increased stability

    • FACS-based sorting for homogeneous expression

    • Single cell cloning to identify optimal expressors

  • Culture condition adjustments:

    • Temperature reduction during expression phases (30-32°C)

    • Addition of chemical chaperones to improve folding

    • Supplementation with receptor ligands as pharmacological chaperones

  • Cell line selection considerations:

    • Testing multiple host cell backgrounds (HEK293, CHO, U2OS)

    • Evaluation of tetracycline-regulated expression systems

    • Assessment of constitutive vs. inducible expression strategies

When establishing stable lines, validation should include verification of receptor expression level, membrane localization, and functional responses to selective agonists. Quantitative approaches such as radioligand binding assays can determine receptor density, while calcium flux or β-arrestin recruitment assays confirm functional activity .

How can mouse Tacr2 research inform understanding of human TACR2-related conditions?

Mouse models provide valuable insights into human conditions involving TACR2 signaling:

  • Pathophysiological relevance:

    • Respiratory disorders: Asthma and chronic obstructive pulmonary disease

    • Gastrointestinal conditions: Irritable bowel syndrome and inflammatory bowel disease

    • Neuropsychiatric disorders: Anxiety and depression

    • Pain syndromes: Visceral and inflammatory pain

  • Translational considerations:

    • Species differences in receptor pharmacology

    • Variations in physiological regulatory mechanisms

    • Differences in expression patterns across tissues

  • Clinical relevance of previous drug development efforts:

    • Saredutant showed mixed results in clinical trials for anxiety/depression

    • Ibodutant failed Phase 3 trials for IBS treatment in 2015

    • Lessons from these clinical trials inform future therapeutic strategies

When conducting translational research, careful documentation of species differences and integration of human tissue studies alongside mouse models strengthens the validity of findings. Comparative pharmacology studies examining responses to the same compounds in both species provide particularly valuable insights for drug development programs.

What are the best practices for experimental design when investigating Tacr2 signaling in neurological processes?

Neurological research with Tacr2 requires specialized methodological considerations:

  • Brain region-specific approaches:

    • Stereotaxic injection of viral vectors for localized manipulation

    • Microdissection techniques for region-specific expression analysis

    • Electrophysiological recordings from relevant neural circuits

  • Behavioral assessment methods:

    • Selection of validated behavioral paradigms relevant to tachykinin function

    • Consideration of sex differences in behavioral responses

    • Integration of physiological measures with behavioral outcomes

  • Pathway dissection strategies:

    • Optogenetic or chemogenetic manipulation of specific neural populations

    • Circuit tracing to identify Tacr2-expressing neuronal networks

    • In vivo calcium imaging during behavioral tasks

  • Translational considerations:

    • Relevance of mouse behavioral measures to human conditions

    • Comparative neuroanatomy between species

    • Integration with human neuroimaging findings

Experimental design should incorporate appropriate controls, blinded assessment where possible, and sufficient statistical power. The age of experimental animals is particularly important, as neurological systems show significant developmental regulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.