Recombinant Mouse Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (Sdhc)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Sdhc; Succinate dehydrogenase cytochrome b560 subunit, mitochondrial; Integral membrane protein CII-3; QPs-1; QPs1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-169
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
LGTTAKEEMERFWKKNTSSNRPLSPHLTIYKWSLPMALSVCHRGSGIALSGGVSLFGLSA LLLPGNFESYLMFVKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLGKGLAIPQVW LSGVAVVVLAVLSSGGLAAL
Uniprot No.

Target Background

Function

Membrane-anchoring subunit of succinate dehydrogenase (SDH), a component of mitochondrial Complex II. SDHC is responsible for electron transfer from succinate to ubiquinone (coenzyme Q) within the electron transport chain.

Gene References Into Functions
  1. Studies demonstrate that the Tet-mev-1 conditional transgenic system can induce SDHC gene mutations in Complex II. PMID: 23142169
  2. Complex II plays a crucial role in hypoxic reactive oxygen species production. PMID: 12676762
  3. SDHC acts as a sensor for apoptosis induction. PMID: 12925748
Database Links
Protein Families
Cytochrome b560 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is mouse Sdhc protein and what is its role in mitochondrial function?

Mouse Sdhc (succinate dehydrogenase complex subunit C), also known as cytochrome b560 (QPs1), functions as a membrane-anchoring subunit for the water-soluble succinate dehydrogenase component in the mitochondrial inner membrane. Structurally, Sdhc is a transmembranous protein with an approximate molecular weight of 14,320 daltons based on amino acid sequence analysis, though it may appear as approximately 11,000 daltons when analyzed by SDS-polyacrylamide gel electrophoresis . The protein contains three probable membrane-spanning segments as revealed by hydropathy plot analysis .

Functionally, Sdhc forms part of Complex II of the electron transport chain, anchoring the catalytic components of succinate dehydrogenase to the inner mitochondrial membrane. Its role is essential for the proper functioning of the citric acid cycle and cellular respiration. Loss of function in the SDH complex can predispose to the development of tumors including phaeochromocytoma/paraganglioma (PPGL), wild type gastrointestinal stromal tumour (wtGIST), and renal cell carcinoma .

What conserved domains are present in mouse Sdhc protein?

Mouse Sdhc contains highly conserved domains that are evolutionarily preserved across species. Most notably, it has two conserved histidines at positions 34 and 90 that are critical for heme ligation of cytochrome b560 . These histidines are strategically located on the matrix-side surface of the mitochondrial membrane and are thought to be directly involved in the coordination of heme groups.

Comparative analysis reveals that mouse Sdhc protein shares higher sequence similarity to the sdhC peptide of Escherichia coli compared to the sdhC peptide (cytochrome b558) of Bacillus subtilis . This conservation across evolutionarily distant species underscores the fundamental importance of these structural elements for the protein's function in energy metabolism. The preservation of these domains makes Sdhc an excellent target for evolutionary and functional studies.

How are conditional knockout mouse models of Sdhc created and what phenotypes do they exhibit?

Conditional knockout mouse models of Sdhc are created using site-specific recombination systems, typically the Cre-loxP system. The process involves several key steps:

  • Generation of mice with loxP recombination sites flanking critical exons (commonly exon 4) of the Sdhc gene

  • Crossing these floxed (fl) mice with mice expressing flippase recombinase (FLP) to excise any gene trap elements

  • Further crossing with mice expressing Cre recombinase under control of specific promoters for tissue-specific or inducible expression

  • For inducible systems, administering inducers such as doxycycline to activate Cre expression

For example, researchers have created SDHC fl/+ and SDHC fl/fl conditional knockout mice on the R26 rtTA SDHC fl/fl tetO-Cre background, which allows for disruption of the SDHC fl alleles through Cre recombination upon doxycycline treatment .

Phenotypically, inducible systemic loss of the Sdhc gene is lethal to most mice within 4 weeks, with death accompanied by lactic acidosis and other symptoms resembling a Leigh-like mitochondrial dysfunction syndrome . Interestingly, while heterozygosity for a loss-of-function SDH subunit allele predisposes humans to paraganglioma, this predisposition has not been observed in mice , highlighting important species differences in disease manifestation.

What PCR methods are used to validate Sdhc gene targeting in mouse models?

Validation of Sdhc gene targeting in mouse models requires careful PCR analysis to confirm successful recombination events. Researchers typically extract genomic DNA from isolated mouse tissues at the time of death or after a specified period following induction (e.g., 3 months after doxycycline treatment) .

The PCR validation typically employs specific primer combinations:

  • For detection of the floxed (fl) allele: Primers such as LJM-4429 (5′-CT₂AGA₂CTGATC₄TGC₃-3′) and LJM-4430 (5′-CACTGC₃G₂CTCATAT₃C-3′), which produce a 595 bp amplicon from the intact floxed allele

  • For detection of the recombined allele: Primers such as LJM-4429 combined with LJM-5125, which yield a 560 bp product specifically from the recombined allele following Cre-mediated excision

Typical PCR cycling parameters include initial denaturation (15 min at 95°C), followed by 38 cycles of denaturation (30 s at 95°C), annealing (90 s at 58°C), and extension (2 min at 72°C), with a final extension (10 min at 68°C) . This methodical approach ensures reliable detection of both the floxed and recombined alleles, providing crucial validation of the genetic manipulation.

What methods are available for detecting and quantifying mouse Sdhc protein?

Several complementary methods are available for the detection and quantification of mouse Sdhc protein in experimental samples:

  • Enzyme-Linked Immunosorbent Assay (ELISA):
    Commercial sandwich ELISA kits are available with detection ranges of 0.156-10 ng/mL and sensitivity of 0.071 ng/mL . These kits provide quantitative measurement of Sdhc in various sample types.

    ELISA ParameterSpecification
    MethodSandwich ELISA
    Detection Range0.156-10 ng/mL
    Sensitivity0.071 ng/mL
    ReactivityMouse
    Gene ID66052
  • Western Blotting:
    Antibodies against Sdhc/QPs1 raised in rabbits can be used for immunodetection . This technique enables visualization of protein expression and molecular weight estimation, with purified antibodies characterized by ELISA and Western blotting showing specificity for Sdhc protein .

  • Immunohistochemistry:
    Antibodies against Sdhc can detect its expression in tissue sections, with studies showing that purified antibodies react with both submitochondrial particles (SMP) and mitoplasts . Interestingly, the binding of these antibodies to SMP increases significantly when succinate dehydrogenase is removed from SMP by alkaline treatment, confirming that Sdhc is transmembranous and some of its epitopes are covered by succinate dehydrogenase .

How can epigenetic modifications of the Sdhc gene be analyzed?

Epigenetic modifications of the Sdhc gene, particularly promoter methylation, can be analyzed using several sophisticated techniques:

  • Pyrosequencing-based Methylation Analysis:
    This method works effectively on DNA extracted from archived routine diagnostic FFPE (formalin-fixed paraffin-embedded) material, which is crucial as fresh frozen tumor tissue is rarely available . The technique allows accurate assessment of the methylation status of 12 CpGs in CpG27 in the promoter region of the Sdhc gene . Pyrosequencing offers advantages over alternative methods such as methylation arrays in terms of cost-effectiveness while maintaining accuracy.

  • Correlation with Gene Expression:
    To establish the functional significance of detected methylation, researchers correlate methylation patterns with Sdhc mRNA levels. Hypermethylation of the Sdhc promoter correlates with reduced Sdhc mRNA expression in the same tissue samples . This correlation confirms the biological impact of the epigenetic modification.

  • Comparative Analysis with Normal Tissue:
    For robust interpretation, researchers recommend analyzing both tumor and adjacent normal tissue by RT-PCR to confirm silencing of Sdhc specifically in the tumor tissue . This comparative approach distinguishes pathological epigenetic silencing from normal tissue-specific regulation.

Notably, Sdhc promoter methylation has been identified in 18.7% of tumors in one study, with all cases presenting as SDH-deficient wild-type gastrointestinal stromal tumors (wtGIST) . The development of these analytical methods has facilitated the translation of Sdhc epimutation testing into clinical practice and diagnostic workflows.

How does Sdhc function in heme coordination and electron transport?

Mouse Sdhc plays a critical role in heme coordination and electron transport within the succinate dehydrogenase complex. The protein contains two highly conserved histidine residues at positions 34 and 90 that are strategically positioned on the matrix-side surface of the mitochondrial membrane . These histidines serve as axial ligands for the heme iron in cytochrome b560, which is essential for electron transfer within Complex II.

The functional importance of these histidine residues is supported by their evolutionary conservation across species, from bacteria to mammals . This conservation suggests a fundamental role in the catalytic mechanism of succinate-ubiquinone reductase. The heme group coordinated by these histidines facilitates electron transfer from succinate (via the FAD cofactor in SDHA) to ubiquinone in the membrane, linking the citric acid cycle to the electron transport chain.

Research approaches to study this function include:

  • Site-directed mutagenesis of the conserved histidines

  • Spectroscopic analysis of heme coordination and redox properties

  • Structural studies of the intact complex

  • Kinetic measurements of electron transfer rates

Understanding this aspect of Sdhc function provides insights into both fundamental bioenergetic processes and the pathological consequences of Sdhc mutations.

What are the metabolic consequences of Sdhc dysfunction in experimental models?

Sdhc dysfunction leads to profound metabolic alterations that have been extensively characterized in experimental models:

  • Succinate Accumulation:
    The most immediate consequence of Sdhc dysfunction is the accumulation of succinate due to impaired SDH activity. This metabolic bottleneck disrupts the citric acid cycle and leads to redirection of metabolic flux through alternative pathways.

  • Lactic Acidosis:
    Mouse models with inducible systemic loss of Sdhc develop severe lactic acidosis within 4 weeks . This indicates a shift toward glycolytic metabolism as mitochondrial oxidative phosphorylation becomes compromised.

  • Pseudohypoxic Response:
    Accumulated succinate inhibits α-ketoglutarate-dependent dioxygenases, including HIF prolyl hydroxylases, leading to stabilization of hypoxia-inducible factors even under normoxic conditions. This pseudohypoxic state alters the expression of numerous metabolic genes.

  • Mitochondrial Complex Assembly Defects:
    Sdhc is essential for the proper assembly and stability of Complex II. Its absence leads to impaired assembly or destabilization of the complex, compromising electron transport chain function.

  • Increased Oxidative Stress:
    Dysfunctional Complex II can increase reactive oxygen species production, leading to oxidative damage to mitochondrial and cellular components.

These metabolic consequences contribute to the severe phenotype observed in mouse models, including lethality within 4 weeks after inducible systemic Sdhc loss . The pattern of metabolic disturbance resembles Leigh-like mitochondrial dysfunction syndrome, making these models valuable for studying both rare mitochondrial disorders and more common metabolic diseases.

What are the challenges in generating viable Sdhc-deficient mouse models for long-term studies?

Generating viable Sdhc-deficient mouse models for long-term studies presents several significant challenges:

  • Embryonic Lethality of Complete Knockout:
    Complete loss of Sdhc function is likely embryonically lethal, necessitating conditional approaches for studying its function in vivo . This fundamental limitation requires sophisticated genetic strategies.

  • Rapid Lethality with Inducible Systemic Deletion:
    Even with inducible systems, systemic loss of Sdhc leads to lethality within 4 weeks in most mice . This narrow survival window severely constrains the types of long-term studies that can be performed.

  • Incomplete Recombination:
    Achieving complete recombination at the Sdhc locus in all target cells can be challenging, potentially leading to mosaic expression patterns that complicate data interpretation.

  • Strain-Dependent Effects:
    Genetic background can significantly influence the phenotypic consequences of Sdhc deficiency, requiring careful strain selection and controls.

Researchers have addressed these challenges through several approaches:

  • Tissue-Specific Conditional Knockouts:
    Using tissue-specific Cre drivers to limit Sdhc deletion to organs of interest, potentially avoiding systemic lethality

  • Temporal Control of Gene Deletion:
    Employing doxycycline-inducible systems (e.g., R26 rtTA SDHC fl/fl tetO-Cre) to precisely time the onset of Sdhc deletion

  • Heterozygous Models:
    Studying Sdhc+/- heterozygotes, though these may not fully recapitulate human diseases as heterozygosity for SDH subunit alleles predisposes to paraganglioma in humans but not in mice

  • Hypomorphic Alleles:
    Developing partial loss-of-function models that reduce but do not eliminate Sdhc function

How do species differences between mouse and human Sdhc affect translational research?

Important species differences between mouse and human Sdhc significantly impact translational research:

  • Disease Predisposition:
    A critical difference is that heterozygosity for loss-of-function SDH subunit alleles predisposes humans to paraganglioma, but this predisposition has not been observed in mice . This fundamental difference challenges the development of mouse models for familial paraganglioma.

  • Tissue-Specific Expression Patterns:
    While the core functions of Sdhc are conserved, there may be subtle differences in tissue-specific expression patterns and regulation between species that influence phenotypic outcomes.

  • Metabolic Rate Differences:
    Mice have significantly higher mass-specific metabolic rates than humans, which may affect the kinetics and severity of metabolic disturbances resulting from Sdhc dysfunction.

  • Alternative Splicing Variations:
    Similar to identified novel isoforms in mouse Sdha , there may be species-specific differences in Sdhc splicing variants that contribute to functional diversity.

  • Compensation Mechanisms:
    The capacity for metabolic compensation following Sdhc impairment may differ between species due to variations in metabolic flexibility and redundancy.

These differences necessitate careful consideration when extrapolating findings from mouse models to human disease contexts. Researchers should validate key findings across multiple model systems and use complementary approaches including human cell lines, patient-derived xenografts, and clinical samples to enhance translational relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.