Recombinant Mouse Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (Sdhd)

Shipped with Ice Packs
In Stock

Description

Production and Characterization

The recombinant mouse SDHD protein is synthesized via bacterial expression systems, often with a His-tag for affinity chromatography. Key parameters include:

ParameterValue
Host OrganismE. coli
Purity>90%
Molecular Weight~20 kDa
Concentration200 µg/mL (prior to lyophilization)

Quality Control:

  • Endotoxin Level: <1.0 EU per 1 µg (LAL method) .

  • Storage: Stable at -80°C or 2–8°C for short-term use .

Functional and Biochemical Properties

SDHD forms a heterodimer with SDHC to anchor Complex II in the mitochondrial membrane. Key biochemical roles include:

Electron Transfer Mechanism

  1. Succinate Oxidation: SDHA (flavoprotein subunit) oxidizes succinate to fumarate, releasing electrons .

  2. Electron Relay: Electrons pass through SDHB’s iron-sulfur clusters to the SDHC/SDHD dimer .

  3. Ubiquinone Reduction: SDHD facilitates ubiquinone binding and reduction to ubiquinol via hydrogen bonding (e.g., Tyr83 and Ser27 interactions) .

Enzyme ActivityRole
Succinate DehydrogenaseConverts succinate to fumarate in the TCA cycle .
Ubiquinone ReductaseTransfers electrons to ubiquinone in oxidative phosphorylation .

ELISA and Antibody Validation

  • Mouse SDHD ELISA Kit:

    • Sensitivity: 0.067 ng/mL .

    • Detection Range: 0.16–10 ng/mL .

    • Sample Types: Tissue homogenates, plasma, serum .

Assay ParameterValue
Intra-Assay CV%<8%
Inter-Assay CV%<10%
Recovery (Serum)80–92%

Protein Interaction Studies

  • Western Blotting: Used to detect SDHD in mitochondrial extracts or recombinant protein samples .

  • Blocking Experiments: Recombinant SDHD fragments (e.g., aa 22–66) validate antibody specificity .

Mitochondrial Diseases

  • Complex II Deficiency: Biallelic Sdhd mutations cause infantile cardiomyopathy, encephalomyopathy, and hypertrichosis .

  • Tumor Suppression: Germline Sdhd mutations predispose to paragangliomas/pheochromocytomas via pseudohypoxia-driven angiogenesis .

Disease AssociationMechanism
Mitochondrial EncephalomyopathyLoss of SDHD impairs ATP production, triggering neurodevelopmental regression .
Hereditary ParagangliomaStabilization of HIFα promotes VEGF/EPAS1 signaling, driving tumor growth .

Mouse Models

  • Conditional Knockout (SDHD-ESR): Tamoxifen-inducible deletion in Sdhd reduces succinate-ubiquinone oxidoreductase (SQR) activity to 32% in kidney and 64% in liver, mimicking human mitochondrial dysfunction .

  • HIF1α Activation: SDHD depletion in cell lines upregulates Vegf and Glut1, but not consistently in tissues .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it; we will prioritize development accordingly.
Synonyms
Sdhd; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; CybS; CII-4; QPs3; Succinate dehydrogenase complex subunit D; Succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate-ubiquinone reductase membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
57-159
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
SGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGLGQVVTDYVH GDTLPKAARAGLLALSALTFAGLCYFNYHDVGICRAVAMLWKL
Uniprot No.

Target Background

Function

Function: Recombinant Mouse Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (Sdhd) is a membrane-anchored subunit of succinate dehydrogenase (SDH), a critical component of Complex II in the mitochondrial electron transport chain. Its primary function is to facilitate electron transfer from succinate to ubiquinone (coenzyme Q).

Gene References Into Functions

Related Research:

  1. Sdhd knockout in the thyroid promotes excess thyroid cell growth in mice, suggesting a potential role in tumor initiation. PMID: 28928232
  2. Analysis of hematopoiesis in an inducible SDHD-deficient mouse model (SDHD-ESR) revealed the dependence of undifferentiated hematopoietic stem cells on mitochondrial function. PMID: 27929539
  3. Loss of SDH activity alters the metabolism of non-essential amino acids. PMID: 26522426
  4. Conditional Sdhd knockout in mice upregulates Cdkn1a (p21) in kidney and adrenal tissues, a gene involved in cell cycle regulation, senescence, and cancer. PMID: 24465590
  5. Complete loss of SdhD is insufficient to induce tumorigenesis in mice. PMID: 22711987
  6. SDHD is crucial for forming a stable mitochondrial complex II and is specifically important for hypoxic pulmonary vasoconstriction in intra-acinar vessels. PMID: 22215723
  7. Sdhd knockout in mice does not produce a disease phenotype, suggesting H19 may not initiate paraganglioma/pheochromocytoma (PGL/PC) tumorigenesis. PMID: 19956719
  8. Mitochondrial Sdhd is essential for early embryogenesis, and partial deficiency leads to persistent carotid body glomus cell activation with hypoxia responsiveness. PMID: 15572694
Database Links
Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of SDHD in mouse mitochondria?

Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD) functions as an essential component of complex II (succinate-ubiquinone oxidoreductase) in the mitochondrial respiratory chain. The protein serves as the small subunit (cybS) of cytochrome b, playing a crucial role in electron transport during oxidative phosphorylation. In humans, the SDHD gene was mapped to chromosome 11q23, comprising four exons and three introns extending over 19kb . The mouse homolog shares significant structural similarity, although species-specific variations exist in regulatory elements. The gene contains several binding motifs for transcription factors including nuclear respiratory factors NRF-1 and NRF-2 in its promoter region, indicating sophisticated transcriptional regulation .

Methodologically, when studying SDHD function, researchers should consider its integration within the complete succinate complex, as isolated analysis may not capture its physiological role accurately.

How do mutations in mouse SDHD manifest at the molecular level?

Mutations in SDHD can have profound effects on protein stability and protein-protein interactions within complex II. Using in silico structural prediction analyses such as DUET and mCSM-PPI scoring systems, researchers can predict the consequences of missense mutations on protein stability and protein-protein affinity . These computational approaches utilize models of SDHD and the succinate complex to analyze how specific amino acid substitutions might disrupt the protein's tertiary structure or its interactions with other subunits.

Common mutations observed in SDHD include copy number alterations (CNAs), with exon 4 deletions being particularly prevalent in some studies . The molecular consequences of these mutations include impaired complex II assembly, disrupted electron transport, and potentially increased reactive oxygen species production.

What are the advantages of conditional knockout models for SDHD research?

Conditional knockout models, such as the SDHD-ESR tamoxifen-inducible mouse strain, offer significant advantages over conventional knockouts for SDHD research:

  • Temporal control: Since complete SDHD knockout is embryonically lethal, conditional models allow researchers to induce SDHD deletion at specific timepoints after normal development .

  • Tissue specificity: Conditional models can be designed to delete SDHD in specific tissues, enabling the study of tissue-specific effects .

  • Modeling "second-hit" phenomena: The SDHD-ESR mouse model allows researchers to study the early responses to the "second-hit" in paraganglioma development - specifically the loss of the remaining functional SDHD allele .

When implementing conditional knockout models, researchers should optimize tamoxifen dosing based on their specific experimental needs. For the SDHD-ESR model, both high dose (100 μg/g for four days) and low dose (50 μg/g for two days) tamoxifen administration protocols have been established .

How can cell lines derived from SDHD mouse models advance in vitro research?

Cell lines derived from SDHD mouse models provide controlled systems for mechanistic studies. The literature describes successful derivation of both mouse embryonic fibroblasts (MEFs) and baby mouse kidney (BMK) epithelial cells from the SDHD-ESR mouse . These cell lines offer several methodological advantages:

  • Controlled gene deletion: The accessibility of cultured cells to tamoxifen allows for more precise control of SDHD deletion timing compared to whole animals .

  • Tissue-specific responses: Comparing different cell types (e.g., fibroblasts vs. epithelial cells) can reveal tissue-specific responses to SDHD loss .

  • Long-term studies: Immortalized cell lines enable extended observation periods not feasible in animal models.

When establishing such cell lines, researchers should confirm complete SDHD deletion through genotyping PCR using appropriate primers (e.g., 5′-AATTGTGCAGAAGTGAG-3′, 5′-GCTGCATACGCTTGATC-3′, 5′-CATCAAGGCTCACAGTC-3′) .

What genotyping strategies are most effective for SDHD mouse models?

Effective genotyping is crucial for working with SDHD mouse models. Based on the literature, PCR-based genotyping strategies have proven most reliable. For the SDHD-ESR model, researchers have successfully implemented the following approach:

  • Primer selection: Use primers that span the floxed regions and can detect both wild-type and mutant alleles. The following primer set has been validated: 5′-AATTGTGCAGAAGTGAG-3′, 5′-GCTGCATACGCTTGATC-3′, 5′-CATCAAGGCTCACAGTC-3′ .

  • Tissue sampling: Ear notches or tail tips provide sufficient DNA for reliable genotyping.

  • Controls: Include wild-type homozygous (+/+), heterozygous (+/−), and known mutant samples as controls in each genotyping batch.

This approach allows researchers to distinguish between various genotypes including SdhD^flox/−, SdhD^flox/+, and wild-type configurations .

How should researchers analyze hypoxia signaling pathways in SDHD-deficient models?

When analyzing hypoxia signaling in SDHD-deficient models, researchers should implement a multi-faceted approach:

  • HIF1α protein stabilization: Western blotting for HIF1α can reveal whether SDHD loss leads to the "pseudo-hypoxic drive" hypothesized to contribute to tumorigenesis .

  • Target gene expression: qRT-PCR or RNA-seq to quantify HIF1α target genes can demonstrate pathway activation.

  • Cellular model selection: The "pseudo-hypoxic drive" in SDHD-ESR-derived cell lines differs from that observed in tissues, so experimental design should account for these differences .

  • Timepoint selection: Consider that HIF1α stabilization may be transitory, requiring careful experimental timing after SDHD deletion .

Researchers should note that cell lines derived from SDHD-ESR mice showed different patterns of HIF1α pathway activation compared to tissues, suggesting that cell culture conditions may influence this signaling pathway .

How does SDHD deficiency trigger tumor suppressor pathways?

SDHD deficiency activates several tumor suppressor pathways, most notably the p21 WAF1/Cip1 pathway. Gene expression analysis in SDHD-ESR mouse models revealed consistent upregulation of p21 WAF1/Cip1 in multiple tissues following SDHD deletion . This protein is implicated in cell cycle regulation, survival, and cancer development.

The observed p21 upregulation suggests a checkpoint mechanism is activated upon complete SDHD loss, which must be overcome for tumor transformation to occur. This supports a "third hit" hypothesis for SDHD-related tumorigenesis:

  • First hit: Germline mutation in one SDHD allele

  • Second hit: Loss of the remaining functional allele

  • Third hit: Bypassing the p21-mediated checkpoint mechanism

Methodologically, researchers investigating this phenomenon should employ:

  • Time-course gene expression analysis following SDHD deletion

  • Chromatin immunoprecipitation to identify transcription factor binding

  • Functional validation through p21 knockdown/knockout experiments

What explains the tissue-specific effects of SDHD deficiency?

Large-scale gene expression analysis in SDHD-ESR mice has revealed differential responses to SDHD deletion between tissues, which may underlie the tissue-specificity of SDHD-related tumors . While some responses are consistent across tissues (such as p21 upregulation), many transcriptional changes differ between adrenal medulla and kidney tissue.

To investigate tissue-specific effects, researchers should:

  • Perform comparative transcriptomics across multiple tissues following SDHD deletion

  • Analyze tissue-specific epigenetic landscapes that may influence responses to SDHD loss

  • Consider developmental lineage factors that might predispose certain tissues to SDHD-related pathology

  • Examine tissue-specific metabolic dependencies that may be differentially affected by complex II dysfunction

Understanding these tissue-specific factors has significant implications for developing targeted therapeutic approaches for SDHD-related diseases.

What statistical approaches are most appropriate for analyzing SDHD research data?

Statistical analysis of SDHD research data requires careful consideration of experimental design and data types. Based on methodologies reported in the literature:

  • For microarray data analysis, the Multi-Experiment Viewer has been successfully employed .

  • For survival analysis and penetrance calculations in mutation studies, the 'survfit' function from R's survival package is recommended .

  • For comparing survival distributions between different genotype cohorts, the log-rank test is appropriate .

  • For pedigree analysis in human SDHD mutation studies, software like MENDEL can model the retrospective likelihood of observed mutation status conditional on disease phenotypes .

How can researchers integrate multi-omics data in SDHD functional studies?

SDHD dysfunction affects multiple cellular processes including metabolism, epigenetics, and signaling pathways. To comprehensively understand these effects, researchers should integrate:

  • Transcriptomics: RNA-seq to identify differential gene expression

  • Proteomics: Mass spectrometry to detect changes in protein abundance and post-translational modifications

  • Metabolomics: Analysis of TCA cycle intermediates and other metabolites

  • Epigenomics: Assessment of DNA methylation and histone modifications

Data integration can be approached through:

  • Pathway analysis tools that can incorporate multiple data types

  • Machine learning algorithms to identify patterns across datasets

  • Network analysis to map interactions between different molecular entities

This multi-omics approach provides a systems-level understanding of how SDHD deficiency impacts cellular physiology and potentially leads to disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.