Recombinant Mouse Succinate receptor 1 (Sucnr1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Physiology and Disease

Mouse Sucnr1 regulates diverse pathways through succinate signaling:

  • Metabolic Regulation:

    • Enhances insulin secretion in pancreatic β-cells via Gq-PKC pathways under hyperglycemic conditions .

    • Sucnr1-βKO mice exhibit impaired glucose tolerance and insulin secretion during high-fat diets .

  • Immune Modulation:

    • Promotes anti-inflammatory phenotypes in macrophages and microglia, resolving neuroinflammation in models like experimental autoimmune encephalomyelitis (EAE) .

  • Bone Homeostasis:

    • Drives osteoclast differentiation and bone resorption via RANKL-independent pathways .

Research Applications

Recombinant Mouse Sucnr1 is used to study:

  • Ligand-Receptor Interactions: Binding assays with succinate or synthetic agonists (e.g., cis-epoxysuccinate) .

  • Signal Transduction: Gq/11-dependent pathways in immune cells and β-cells .

  • Disease Models:

    • Diabetes: Investigating β-cell dysfunction in diet-induced obesity .

    • Osteoporosis: Assessing osteoclastogenesis in hyperglycemic mice .

Table 2: Key Experimental Models Using Recombinant Sucnr1

ModelFindingsReference
High-Fat Diet MiceImpaired insulin secretion in Sucnr1-βKO mice
Osteoclast CultureSUCNR1 activation increases RANKL-induced bone resorption
EAE ModelSUCNR1 in microglia promotes anti-inflammatory prostaglandin E2 release

Comparative Analysis Across Species

Mouse Sucnr1 shares 80–90% homology with human SUCNR1 (GPR91), but functional differences exist:

  • Tissue Specificity: Mouse Sucnr1 is highly expressed in β-cells and myeloid cells, unlike human SUCNR1, which shows broader immune cell activity .

  • Pathway Activation: Mouse osteoclasts rely on SUCNR1 for differentiation, whereas human mast cells use SUCNR1 to amplify IgE-mediated histamine release .

Table 3: Species-Specific SUCNR1 Features

SpeciesExpression ProfileKey Function
MousePancreatic β-cells, Myeloid cellsInsulin secretion, Osteoclastogenesis
HumanMast cells, MacrophagesAllergic inflammation, Cytokine release

Key Research Findings

  1. Metabolic Dysregulation:

    • SUCNR1 activation in mouse β-cells potentiates glucose-stimulated insulin secretion, a mechanism blunted in Sucnr1-βKO mice .

    • Serum succinate levels correlate with SUCNR1 upregulation in obese mice and humans .

  2. Inflammatory Resolution:

    • SUCNR1 signaling in mouse microglia reduces neuroinflammation via prostaglandin E2 and succinate scavenging .

  3. Bone Remodeling:

    • SUCNR1-deficient mice show reduced osteoclast formation and bone loss in hyperglycemic conditions .

Technical Considerations

  • Antibodies: Anti-SUCNR1 clones (e.g., 1N21) enable ELISA, Western blot, and immunohistochemistry .

  • siRNA/shRNA: MISSION® esiRNA and custom shRNA libraries facilitate gene knockdown studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sucnr1; Gpr91; Succinate receptor 1; G-protein coupled receptor 91
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAQNLSCENWLATEAILNKYYLSAFYAIEFIFGLLGNVTVVFGYLFCMKNWNSSNVYLFN LSISDFAFLCTLPILIKSYANDKGTYGDVLCISNRYVLHTNLYTSILFLTFISMDRYLLM KYPFREHFLQKKEFAILISLAVWALVTLEVLPMLTFINSVPKEEGSNCIDYASSGNPEHN LIYSLCLTLLGFLIPLSVMCFFYYKMVVFLKRRSQQQATALPLDKPQRLVVLAVVIFSIL FTPYHIMRNLRIASRLDSWPQGCTQKAIKSIYTLTRPLAFLNSAINPIFYFLMGDHYREM LISKFRQYFKSLTSFRT
Uniprot No.

Target Background

Function
Succinate Receptor 1 (Sucnr1) functions as a receptor for succinate, a key intermediate in the citric acid cycle.
Gene References Into Functions
  1. Succinate accumulation impairs cardiac pyruvate dehydrogenase activity through GRP91-dependent and independent signaling pathways, leading to potential therapeutic effects of ginsenoside Rb1. PMID: 28736181
  2. Succinate acts as an extracellular ligand by binding to its specific receptor on osteoclastic lineage cells, stimulating osteoclastogenesis in vitro and in vivo. Inhibition of Sucnr1 activation represents a potential strategy for inhibiting osteoclastogenesis. PMID: 28561074
  3. Activation of SUCNR1 in macrophages plays a crucial role in both infiltration and inflammation of adipose tissue during obesity. PMID: 28382382
  4. Metformin demonstrates the ability to attenuate the activation of hepatic stellate cells by activating the AMPK pathway and inhibiting the succinate-GPR91 pathway, suggesting potential therapeutic benefits for treating steatohepatitis and liver fibrosis. PMID: 29278707
  5. This study highlights the expression of GPR91 on mouse and human mast cells, revealing a hyperactive behavior of mouse Sucnr1-/- mast cells in a mechanistic in vivo model of skin inflammation. PMID: 27527650
  6. Sucnr1 knockout mice exhibit increased energy expenditure, reduced white adipose tissue, and improved glucose buffering compared to controls. However, they develop progressive hyperglycemia and fail to secrete insulin, suggesting a role for Sucrn1 as a sensor for dietary energy. PMID: 25352636
  7. These findings suggest that SUCNR1 deficiency may contribute to the pathogenesis of dry age-related macular degeneration. PMID: 23833031
  8. GPR91 is expressed in the retinal pigment epithelium with specific localization to the apical membrane, indicating that succinate in the subretinal space serves as the GPR91 agonist. PMID: 21357408
  9. SUCNR1 is located in the luminal membrane of macula densa cells of the juxtaglomerular apparatus, in close proximity to renin-producing granular cells, the cortical thick ascending limb, and cortical and inner medullary collecting duct cells. PMID: 19776718
  10. GPR91, previously an orphan G-protein-coupled receptor, has been identified as a receptor for the citric acid cycle intermediate succinate. PMID: 15141213
  11. The release of the prohypertensive hormone renin by the kidney, triggered by high glucose levels, is mediated by a succinate / GPR91 paracrine signaling cascade in the glomerular endothelium. PMID: 18535668
  12. Macula densa cells can sense alterations in local tissue metabolism through the accumulation of tubular succinate and subsequent GPR91 signaling. PMID: 19389848
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in the kidney (proximal and distal tubules and the juxtaglomerular apparatus). Weakly expressed in liver, spleen and small intestine.

Q&A

What is the molecular structure of Mouse Sucnr1 and how does it compare to human SUCNR1?

Mouse Sucnr1 (also known as GPR91) is a G-protein coupled receptor with seven transmembrane domains connected by three hydrophilic extracellular loops. The receptor contains specific N-glycosylation sites and phosphorylation sites that regulate its function and stability. Recent structural studies have revealed detailed insights into the SUCNR1-Gi complex at near-atomic resolution (approximately 3 Å) .

The binding pocket of Sucnr1 is relatively large compared to the size of succinate . Key residues involved in succinate recognition and signaling have been identified through site-directed mutagenesis, including R281 (position 7.39), which is essential for G protein activation. Additional important residues include Y30 (position 1.39), Y83 (position 2.64), and F175 in the extracellular loop 2 (ECL2) . These structural features are largely conserved between mouse and human SUCNR1, though specific amino acid variations may influence ligand specificity and signaling efficiency.

Methodologically, researchers studying Sucnr1 structure should consider employing a combination of cryo-electron microscopy, X-ray crystallography, and computational modeling approaches to fully characterize species-specific structural features.

What expression systems are optimal for producing functional recombinant mouse Sucnr1?

Multiple expression systems have been successfully employed to produce recombinant mouse Sucnr1, each offering distinct advantages for different research applications:

  • Cell-free expression systems provide rapid protein production with minimal cellular interference .

  • E. coli, yeast, baculovirus, and mammalian cell systems offer varying degrees of post-translational modifications and protein yields .

  • For structural studies requiring purified receptor-G protein complexes, insect cell (Sf9) expression systems have proven effective, as demonstrated in recent structural investigations .

  • Mammalian expression systems (HEK293, CHO cells) are preferred for functional studies as they provide appropriate G-protein coupling machinery.

For optimal results, researchers should consider:

  • Including appropriate affinity tags (such as N-terminal FLAG tags) for purification

  • Co-expressing the receptor with relevant G proteins when studying complex formation

  • Adding specific ligands (succinate or cis-epoxysuccinate) during purification to stabilize active conformations

  • Employing protein engineering strategies to improve expression levels while maintaining function

The purity of recombinant Sucnr1 preparations is typically assessed by SDS-PAGE, with commercially available preparations achieving ≥85% purity .

What methodologies are most effective for validating recombinant mouse Sucnr1 activity?

Comprehensive validation of recombinant mouse Sucnr1 activity requires multiple complementary approaches:

Validation MethodAssay TypeMeasurement ParameterTechnical Considerations
G-Protein CouplingcAMP inhibition assayReduction in cAMP levelsUse ELISA or BRET-based biosensors
G protein dissociation assayG protein activationAnalyze dose-response with log[agonist] vs. response equation
Ligand BindingRadioligand bindingBinding affinity (Kd)Use tritiated succinate with appropriate controls
Signaling Pathway ActivationERK1/2 phosphorylationMAPK pathway activationWestern blotting following succinate stimulation
Mutational AnalysisSite-directed mutagenesisReduction in signalingR281A mutation serves as negative control
Cellular LocalizationFlow cytometrySurface expressionCompare to wild-type expression levels (100%)

Data from functional assays should be expressed as percentages (mean ± SEM) relative to maximal response levels, based on at least three independent experiments . Proper statistical analysis of EC50 values extracted from dose-response curves is essential for rigorous characterization.

Combining these methodologies provides robust validation of recombinant Sucnr1 activity across different aspects of receptor function.

How do succinate and synthetic agonists differ in their activation of mouse Sucnr1?

Succinate (the natural ligand) and synthetic agonists like cis-epoxysuccinate exhibit distinct properties in activating mouse Sucnr1:

The natural agonist succinate binds to the transmembrane pocket of Sucnr1, interacting with positively charged residues that accommodate its negatively charged carboxylate groups. This interaction triggers specific conformational changes that propagate to the intracellular domains, creating an interface for G protein binding .

Synthetic non-metabolic agonists like cis-epoxysuccinate have been developed to provide more stable alternatives for structural and functional studies. Recent cryo-EM structures have compared succinate-SUCNR1-Gi complex (2.97 Å resolution) with epoxysuccinate-SUCNR1-Gi complex (3.15 Å resolution) , revealing subtle differences in receptor conformation that may influence signaling outcomes.

When designing experiments, researchers should consider that:

  • Natural and synthetic agonists may exhibit different binding kinetics and potencies

  • Metabolic stability varies significantly between succinate and synthetic analogs

  • Biased signaling properties may emerge with synthetic compounds

  • Species-specific differences in ligand recognition should be accounted for when translating between mouse and human systems

These considerations are particularly important when developing SUCNR1-targeting compounds with therapeutic potential.

What are the primary signaling pathways activated by mouse Sucnr1 and how are they regulated?

Mouse Sucnr1 activates multiple signaling pathways that vary across different cell types and physiological contexts:

  • G protein-dependent pathways:

    • Primarily couples to Gi proteins, leading to inhibition of adenylyl cyclase and decreased cAMP levels

    • Activation of MAPK-ERK1/2 signaling pathways

    • Release of Gβγ subunits that can activate phospholipase C

  • Cell-type specific responses:

    • In retinal ganglion cells, Sucnr1 activation increases VEGF and PGE2 release through MAPK-ERK1/2 signaling, promoting vascularization

    • In neural stem cells, Sucnr1 signaling induces PGE2 secretion and extracellular succinate scavenging, contributing to resolution of neuroinflammation

    • In macrophages, Sucnr1 can promote anti-inflammatory phenotypes under specific conditions

Regulation of these pathways involves multiple mechanisms including receptor desensitization, internalization, and cross-talk with other signaling systems. The phosphorylation site (analogous to Ser326 in human SUCNR1) likely plays a role in regulating receptor activity and trafficking .

Methodologically, researchers investigating these pathways should employ pathway-specific inhibitors, siRNA knockdowns, and phosphoproteomic analyses to delineate the precise signaling networks in each cellular context.

How does the molecular mechanism of Sucnr1-mediated G protein activation inform structure-based drug design?

Recent structural insights into SUCNR1-Gi complexes provide a foundation for structure-based drug design targeting Sucnr1:

The high-resolution structures of succinate-SUCNR1-Gi complex (2.97 Å) and epoxysuccinate-SUCNR1-Gi complex (3.15 Å) reveal the precise arrangement of the transmembrane binding pocket and G protein interaction interface. Functional validation through mutagenesis has identified R281 (position 7.39) as essential for G protein activation, while Y30 (position 1.39), Y83 (position 2.64), and F175 (ECL2) contribute moderately to signal transduction .

These structural and functional insights inform several approaches to drug design:

  • Virtual screening strategies can now use the actual receptor structure rather than homology models based on the P2Y1 receptor (27% homology)

  • Structure-activity relationship studies can focus on optimizing interactions with key binding pocket residues

  • Biased ligand development can target specific receptor conformations that preferentially activate beneficial signaling pathways

  • Species-selective compounds can be designed based on structural differences between mouse and human receptors

To validate candidate compounds, researchers should employ a combination of in silico binding predictions, in vitro functional assays (cAMP inhibition, G protein dissociation), and mutagenesis studies targeting key binding residues .

What is the role of mouse Sucnr1 in neuroinflammation and how can recombinant Sucnr1 be used in CNS disease models?

Mouse Sucnr1 plays complex roles in neuroinflammation, with both pro- and anti-inflammatory effects depending on context:

Elevated succinate levels have been detected in the cerebrospinal fluid (not peripheral blood) during experimental autoimmune encephalomyelitis (EAE), a mouse model of multiple sclerosis . This CSF succinate, likely released by pro-inflammatory macrophages and microglia, signals through Sucnr1 on neural stem cells (NSCs) to initiate anti-inflammatory responses. Specifically, NSCs secrete prostaglandin E2 and scavenge extracellular succinate, contributing to resolution of neuroinflammation .

Myeloid cell-specific Sucnr1 conditional knockout mice (LysMCreSucnr1fl/fl) have confirmed the anti-inflammatory role of SUCNR1 in vivo, showing that Sucnr1 in mouse macrophages can induce a predominantly anti-inflammatory phenotype .

Recombinant Sucnr1 can be applied in CNS disease research through:

  • Development of binding assays for screening CNS-permeable therapeutic compounds

  • Generation of specific antibodies for monitoring receptor expression in different CNS cell types

  • Production of soluble decoy receptors to modulate extracellular succinate levels

  • Structure-guided design of Sucnr1 modulators with improved CNS permeability

When designing experiments for neuroinflammation models, researchers must consider the cell- and context-specific effects of Sucnr1 signaling and the CNS-permeability of any prospective succinate analogs .

How does Sucnr1 contribute to vascular regulation in mouse models?

Sucnr1 plays significant roles in vascular regulation through multiple mechanisms:

In rodent retinal ganglion cells, activation of the succinate-Sucnr1 axis increases the release of vascular endothelial growth factor (VEGF) and prostaglandin E2 (PGE2), promoting vascularization through the MAPK-ERK1/2 signaling pathway . This has been demonstrated both in vitro and in vivo, where siRNA-mediated retinal down-regulation of Sucnr1 in wild-type rats abolishes neovascularization in the presence of succinate .

This vascular regulatory function is particularly relevant in pathological settings such as hypoxic-ischemic injury, where succinate can accumulate due to altered metabolism . While Sucnr1-mediated angiogenesis can be beneficial for tissue repair, excessive activation may contribute to pathological neovascularization in certain contexts.

Methodologically, researchers studying Sucnr1 in vascular regulation should consider:

  • Using tissue-specific conditional knockout models to isolate vascular effects

  • Employing in vivo imaging techniques to monitor vascular changes following Sucnr1 modulation

  • Measuring local succinate concentrations in tissues undergoing vascular remodeling

  • Combining pharmacological and genetic approaches to confirm receptor specificity

These approaches can help elucidate the therapeutic potential of targeting Sucnr1 in vascular disorders.

What strategies can overcome challenges in developing selective modulators of mouse Sucnr1?

Developing selective modulators of mouse Sucnr1 presents several challenges that require strategic approaches:

ChallengeStrategyMethodological Considerations
Binding pocket sizeFragment-based drug designThe binding pocket is large relative to succinate size ; use fragments that can be expanded to fill the pocket
Selectivity issuesStructure-guided designLeverage recent high-resolution structures (2.97-3.15 Å) to target Sucnr1-specific features
CNS penetrationPhysicochemical optimizationConsider blood-brain barrier permeability for CNS applications
Species differencesComparative structural analysisCompare binding sites between mouse/human receptors to ensure translational relevance
Functional validationComprehensive assay panelUse cAMP inhibition and G protein dissociation assays with mutational controls

Recent progress has included the development of synthetic non-metabolic agonists like cis-epoxysuccinate and antagonists such as NF-56-EJ40 . Virtual screening approaches based on receptor structure have identified non-metabolite agonists .

For rigorous validation of new compounds, researchers should employ dose-response analyses using the "log[agonist] vs. response" equation and express results as percentages relative to maximal response levels .

How can single-cell techniques advance our understanding of heterogeneous Sucnr1 responses in complex tissues?

Single-cell approaches offer powerful tools to unravel the context-dependent signaling of Sucnr1 in heterogeneous tissues:

  • Single-cell transcriptomics can map Sucnr1 expression across diverse cell populations within complex tissues like the brain or immune system. This can reveal how Sucnr1 expression correlates with specific cellular states and help resolve apparently contradictory findings in different cell types.

  • Single-cell proteomics and phosphoproteomics can profile how the same ligand (succinate) induces different signaling patterns in distinct cell types. This is particularly relevant given the diverse outcomes of Sucnr1 activation observed in different contexts, from pro-inflammatory to anti-inflammatory effects .

  • Live-cell imaging with fluorescent biosensors for second messengers (cAMP, Ca²⁺) and kinase activities can track Sucnr1 signaling dynamics in real-time at the single-cell level, revealing temporal aspects that may be missed in population-level analyses.

  • CRISPR-based genetic screens in primary cell populations can identify cell-type specific regulators and effectors of Sucnr1 signaling, helping to explain differential responses across cell types.

These approaches can help resolve the complexity of Sucnr1 signaling seen in various studies, such as its seemingly contradictory roles in inflammation versus resolution , by revealing how cellular context shapes receptor signaling outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.