Recombinant Mouse Sugar transporter SWEET1 (Slc50a1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse SWEET1

Recombinant Mouse SWEET1 (Solute Carrier Family 50 Member 1, SLC50A1) is a laboratory-synthesized version of the transmembrane protein responsible for mediating sugar transport across cellular membranes . It plays a key role in glucose homeostasis and has been implicated in metabolic disorders such as diabetes and cancer . The recombinant form enables precise experimental manipulation, overcoming challenges associated with isolating native proteins from biological samples .

Production Methods

Recombinant Mouse SWEET1 is synthesized via cell-free protein expression systems (e.g., Nicotiana tabacum), followed by Strep-tag purification . This method ensures high purity (>95%) and avoids contamination from mammalian cell metabolites .

Research Applications

ApplicationDetails
Metabolic StudiesQuantifies glucose uptake and glycolysis in cancer cells .
Drug ResistanceLinked to doxorubicin resistance in hepatocellular carcinoma via glycolysis regulation .
ELISA-Based DetectionUsed in kits (e.g., Assay Genie MOEB1431, Abbexa) for measuring SWEET1 levels in serum, plasma, and tissue lysates .
Protein Interaction StudiesInvestigates binding partners like TRPV2 and RAG1 .

Functional Insights from Recent Studies

  • Glycolytic Regulation: SWEET1 knockdown reduces glucose uptake by 40–60%, ATP production by 35%, and lactate levels by 45% in hepatocellular carcinoma cells .

  • Cell Cycle Modulation: Overexpression accelerates G1/S transition, promoting tumor proliferation .

  • Therapeutic Target: Silencing SWEET1 enhances chemotherapy sensitivity (e.g., doxorubicin) .

Assay Performance (ELISA Kits)

ParameterValue
Detection Range78–5,000 pg/mL
Sensitivity39.4 pg/mL
Intra-Assay CV6.2%
Inter-Assay CV8.5%
Sample TypesSerum, plasma, tissue lysates

Protein Properties

PropertyDetail
Molecular Weight24,649 Da
UniProt EntrySWET1_MOUSE (Q9CXK4)
Storage-20°C (lyophilized); 4°C (reconstituted)

Future Directions

Current research focuses on SWEET1’s role in DNA damage repair and its interaction with m6A methyltransferase METTL3 . These findings highlight its potential as a biomarker for metabolic diseases and a target for combination therapies in oncology .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc50a1; Rag1ap1; Rga; Sugar transporter SWEET1; MmSWEET1; RAG1-activating protein 1; Solute carrier family 50 member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc50a1
Target Protein Sequence
MEAGGVADSFLSSACVLFTLGMFSTGLSDLRHMQRTRSVDNIQFLPFLTTDVNNLSWLSY GVLKGDGTLIIVNSVGAVLQTLYILAYLHYSPQKHGVLLQTATLLAVLLLGYGYFWLLVP DLEARLQQLGLFCSVFTISMYLSPLADLAKIVQTKSTQRLSFSLTIATLFCSASWSIYGF RLRDPYITVPNLPGILTSLIRLGLFCKYPPEQDRKYRLLQT
Uniprot No.

Target Background

Function
Facilitates sugar transport across cellular membranes. May regulate the expression of RAG1, a gene involved in V(D)J recombination.
Gene References Into Functions
  1. Demonstrates novel protein-protein interaction with TRPV2 PMID: 14991772
  2. RGA participates in the control of transient receptor potential cation channel, subfamily V, member 2 surface levels PMID: 15547947
Database Links
Protein Families
SWEET sugar transporter family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high levels in lung, placenta, spleen and thymus, at intermediate levels in brain, heart, kidney and testis, and at low levels in bone marrow, liver and lymph node. Within the thymus expression is highest in non-lymphoid cells.

Q&A

What is mouse Sugar transporter SWEET1 (Slc50a1) and what is its primary function?

Mouse Sugar transporter SWEET1 (Slc50a1), also known as RAG1-activating protein 1, MmSWEET1, Rag1ap1, or Rga, is a member of the SWEET (Sugars Will Eventually be Exported Transporters) family. It functions primarily as a membrane protein that mediates sugar transport across cell membranes, playing a crucial role in glucose homeostasis and metabolism in mice .

SWEET1 is encoded by the SLC50A1 gene, comprising 221 amino acids with a molecular weight of approximately 25 kDa. The protein is localized in multiple cellular compartments, including the plasma membrane, Golgi apparatus, and nucleus . This strategic distribution enables it to participate in various cellular processes related to sugar metabolism.

Beyond its role in sugar transport, SWEET1 may also regulate the expression of RAG1, a gene involved in V(D)J recombination, suggesting potential functions in immune system development . The dysregulation of SWEET1 has been linked to various metabolic disorders and diseases, making it an important target for research into metabolic pathways and potential therapeutic interventions .

What experimental methods are commonly used to detect and quantify mouse SWEET1 expression?

Several robust analytical techniques can be employed for detecting and quantifying mouse SWEET1 expression in research settings:

  • Enzyme-Linked Immunosorbent Assay (ELISA): Commercially available ELISA kits designed specifically for mouse Sugar transporter SWEET1 provide high sensitivity (as low as 39.4 pg/mL) and specificity. These kits can detect SWEET1 in serum, plasma, tissue homogenates, and cell culture supernatants with detection ranges typically between 78-5000 pg/ml .

  • Semi-quantitative Real-Time PCR: This technique allows for the measurement of SWEET1 mRNA expression levels using gene-specific primer sets. For optimal results, researchers should design primers using tools like NCBI Primer-Blast and validate specificity through melting curve analysis. Data analysis using the comparative Ct method (2^-ΔΔCt) enables relative quantification of target gene expression .

  • Western Blotting: For protein-level detection, Western blotting with antibodies specific to mouse SWEET1 can be employed, though care must be taken to optimize protocols for this membrane protein.

  • Immunohistochemistry/Immunofluorescence: These techniques are valuable for visualizing the cellular and subcellular localization of SWEET1 in tissue sections or cultured cells.

  • Bioinformatics Analysis: Online tools such as GOBO, Oncomine, and GEO datasets can be utilized to analyze SWEET1 expression patterns across different tissues, experimental conditions, or disease states .

When selecting a method, researchers should consider factors such as the specific research question, sample type, availability of reagents, and required sensitivity/specificity parameters.

How does mouse SWEET1 differ from other sugar transporters in terms of structure and function?

Mouse SWEET1 represents a distinct class of sugar transporters compared to the more extensively studied SLC2 (GLUT) and SLC5 (SGLT) families, with several distinguishing characteristics:

Structural Distinctions:

  • SWEET1 belongs to the SLC50 family, a relatively newly discovered class of glucose transport proteins .

  • While the SLC family comprises 65 families with approximately 400 members, SWEET transporters have a unique structure that differentiates them from other sugar transporters .

  • Unlike the multi-transmembrane domain structures of GLUTs, SWEET1 has a smaller molecular weight (25 kDa) and different membrane topology .

Functional Differences:

  • SWEET1 is primarily found in the Golgi complex and functions as a component of the vesicular exocytosis pathway, participating in glucose efflux in intestinal and liver cells .

  • Unlike many other transporters that function solely at the plasma membrane, SWEET1 has broader subcellular distribution, including the plasma membrane, Golgi apparatus, and nucleus .

  • SWEET1 has been shown to recognize and transport multiple substrates with varying affinities, including D-glucose, D-fructose, and D-mannose, as well as several sugar analogs like 1-deoxynojirimycin and 1-thio-D-glucose .

  • Beyond direct transport, SWEET1 can influence the expression of other glucose transporters. For example, in goat mammary gland epithelial cells, SWEET1 can activate AKT signaling, resulting in increased expression of GLUT1, GLUT4, and GLUT14 .

These structural and functional differences highlight the unique role of SWEET1 in cellular sugar metabolism and suggest potential specialized functions that warrant further investigation in metabolic research.

What are the optimal experimental models for studying mouse SWEET1 function?

Selecting the appropriate experimental model is crucial for investigating SWEET1 function. Based on current research approaches, the following models offer distinct advantages:

Cell Culture Models:

  • Mouse hepatocytes: Particularly useful for studying SWEET1's role in glucose transport and metabolism in the liver, where it participates in glucose efflux .

  • Mouse breast cancer cell lines: Valuable for investigating SWEET1's potential role as a biomarker and its functional significance in cancer metabolism .

  • Yeast expression systems: Engineered yeast strains lacking endogenous hexose transporters (like EBY4000) provide an excellent model for studying SWEET1 transport specificity and kinetics in isolation .

Biosensor Technologies:

  • SweetTrac systems: These biosensors, constructed by the intramolecular fusion of conformation-sensitive fluorescent proteins to SWEET transporters, enable real-time monitoring of substrate binding and transport. The SweetTrac1 biosensor based on Arabidopsis SWEET1 has been used to identify transported substrates and can be adapted for mouse SWEET1 studies .

Animal Models:

  • Transgenic mouse models: Overexpression or knockout models of SLC50A1 can provide insights into its physiological roles in whole-body metabolism.

  • Patient-derived xenograft (PDX) models: For cancer-related studies, PDX models can help assess the role of SWEET1 in tumor progression and therapeutic response .

Computational Models:

  • Structure-based models: Computational approaches can predict substrate binding sites and transport mechanisms based on homology with characterized SWEET transporters, such as Arabidopsis SWEET1 and SWEET2 .

When selecting a model system, researchers should consider the specific aspects of SWEET1 function they aim to investigate, as different models may highlight distinct facets of its biological roles.

What is known about tissue-specific expression patterns of mouse SWEET1?

The tissue distribution of mouse SWEET1 reflects its diverse physiological roles and provides insights into potential functions in different organ systems:

Expression Profile:
Mouse SWEET1 shows differential expression across tissues, with notable presence in:

  • Liver: Where it participates in glucose efflux and may influence metabolic pathways relevant to hepatocellular carcinoma .

  • Mammary tissue: Studies in mammals suggest SWEET1 contributes to lactose synthesis in mammary glands by providing glucose .

  • Immune cells: Given its potential role in regulating RAG1 expression, SWEET1 may have specific functions in immune cell development .

Regulatory Factors:
The expression of SWEET1 appears to be influenced by several factors:

  • Developmental stage: Expression levels may vary during different developmental periods.

  • Metabolic state: Glucose availability and metabolic demands may modulate SWEET1 expression.

  • Disease conditions: In pathological states such as cancer, SWEET1 expression is often dysregulated, with upregulation observed in breast cancer and hepatocellular carcinoma .

Clinical Correlations:
In human studies, which may provide insights relevant to mouse models:

  • SLC50A1 expression is positively related to histological grade and estrogen receptor (ER) status in breast cancer .

  • Higher expression levels correlate with unfavorable prognosis in hepatocellular carcinoma patients .

Understanding the tissue-specific expression patterns of SWEET1 is essential for designing targeted studies and interpreting results in the context of whole-organism physiology.

How can researchers optimize experimental protocols for studying SWEET1-mediated glucose transport?

Optimizing protocols for investigating SWEET1-mediated glucose transport requires careful consideration of several methodological aspects:

Cellular System Selection and Preparation:

  • Expression systems: Use yeast strains lacking endogenous hexose transporters (e.g., EBY4000) with integrated or plasmid-based expression of mouse SWEET1 to eliminate interference from other transporters .

  • Expression level control: Consider using different promoter strengths or inducible systems. Research indicates that protein levels of SWEET1 correlate with transport efficiency, with higher levels from multicopy plasmids resulting in higher influx rates compared to genome-integrated lines .

  • Subcellular localization verification: Confirm proper localization using tagged versions of SWEET1 and appropriate markers for plasma membrane, Golgi, or other relevant compartments.

Transport Measurement Strategies:

  • Radiolabeled substrates: For direct measurement of transport, use 14C or 3H-labeled sugars. This approach has been successfully employed to confirm cellular uptake of D-glucose, D-fructose, and D-mannose via SWEET1 .

  • Biosensor-based approaches: Consider adapting the SweetTrac biosensor system, which uses conformation-sensitive fluorescent proteins fused to the transporter to monitor substrate binding events in real-time .

  • Metabolic assays: For indirect assessment, measure glycolytic rates or other metabolic parameters affected by glucose uptake.

Kinetic Analysis Optimization:

  • Account for sugar metabolism: When measuring transport of metabolizable sugars like D-glucose, the catabolism can introduce variability. Higher expression levels of the transporter can help offset consumption by glycolysis, allowing cytosolic and extracellular concentrations to equilibrate faster .

  • Concentration range selection: Use an appropriate range of substrate concentrations (typically spanning at least two orders of magnitude around the expected Km) for accurate determination of kinetic parameters.

  • Competition assays: Employ unlabeled substrates or potential inhibitors to distinguish between transport and binding.

Data Analysis Considerations:

  • Initial rate measurements: Focus on linear portions of uptake curves to accurately determine transport rates.

  • Normalization approaches: Consider normalizing to protein expression levels, particularly when comparing different mutants or conditions.

  • Mathematical models: Apply appropriate models (Michaelis-Menten, Hill equation, etc.) based on the transport mechanism.

By carefully optimizing these aspects of experimental design, researchers can generate more reliable and reproducible data on SWEET1-mediated glucose transport.

What approaches can be used to investigate the role of SWEET1 in cancer metabolism?

SWEET1 has emerged as a potential player in cancer metabolism, with implications for both diagnostic and therapeutic developments. Several sophisticated approaches can be employed to elucidate its role:

Expression Analysis in Cancer Models:

  • Multi-omics profiling: Combine transcriptomics, proteomics, and metabolomics to correlate SWEET1 expression with metabolic alterations in cancer cells.

  • Single-cell analysis: Employ single-cell RNA sequencing to identify heterogeneity in SWEET1 expression within tumors and correlate with metabolic phenotypes.

  • Clinical sample validation: As demonstrated in breast cancer studies, compare SWEET1 expression in paired tumor/normal tissues (n=20) and larger patient cohorts (n=85) versus healthy controls (n=30) to establish clinical relevance .

Functional Interrogation:

  • CRISPR-Cas9 genetic manipulation: Generate knockout or knockdown models to assess the direct impact of SWEET1 depletion on cancer cell metabolism, proliferation, and survival.

  • Metabolic flux analysis: Employ isotope-labeled glucose (13C) to track metabolic pathways affected by SWEET1 modulation, particularly glycolytic rates and glucose utilization patterns.

  • Cell cycle analysis: Flow cytometry measurements can reveal how SWEET1 affects cell cycle progression, as downregulation of SLC50A1 has been shown to inhibit liver cancer cell growth by inducing G1 cell cycle arrest .

Therapeutic Resistance Mechanisms:

  • Drug sensitivity profiling: Test how SWEET1 expression levels affect response to metabolic inhibitors or conventional chemotherapeutics like doxorubicin.

  • Combination treatment strategies: Investigate whether inhibiting SWEET1 can sensitize resistant cancer cells to therapy, building on findings that SLC50A1 enhances resistance of HCC cells to DOX and 2-DG .

Diagnostic Biomarker Development:

  • Serum detection methods: Optimize ELISA protocols for detecting circulating SWEET1 in blood samples, similar to approaches that achieved 75.3% sensitivity and 100.0% specificity in breast cancer detection .

  • ROC analysis: Determine appropriate cutoff values for diagnostic applications through receiver operating characteristic analysis, as demonstrated in breast cancer studies (optimal cutoff: 39.679 ng/mL) .

Pathway Integration Analysis:

  • Signaling pathway interactions: Investigate connections between SWEET1 and other pathways, such as the observed relationship between SLC50A1 and METTL3 expression in HCC .

  • Gene Set Enrichment Analysis (GSEA): Employ GSEA to identify pathways associated with SWEET1 expression, including those related to proliferation, cell cycle, glycolysis, apoptosis, drug resistance, and DNA repair .

These multifaceted approaches can provide comprehensive insights into how SWEET1 contributes to cancer metabolism and identify potential avenues for therapeutic intervention.

How does substrate specificity of SWEET1 differ from other sugar transporters, and what methods can reveal these differences?

Understanding the unique substrate specificity profile of SWEET1 compared to other sugar transporters requires sophisticated experimental approaches:

Comprehensive Substrate Screening:

  • Custom library screening: Create or utilize custom libraries of natural and synthetic carbohydrates to systematically test SWEET1 binding preferences. Previous studies with Arabidopsis SWEET1 tested 182 compounds including sugar acids (15%), amino sugars (12%), disaccharides (9%), sugar alcohols (8%), sugar phosphates (8%), aldoses (5%), ketoses (3%), and various modified sugars .

  • High-throughput fluorescence assays: Utilize biosensor systems like SweetTrac to rapidly screen potential substrates based on conformation-induced changes in fluorescent protein reporters fused to the transporter .

Distinguishing Transport from Binding:

  • Combined approaches: To differentiate actual substrates from competitive inhibitors, use biosensor binding data in combination with cellular uptake assays. For example, in studies of Arabidopsis SWEET1, 1-deoxy-1-morpholino-D-fructose produced a fluorescence response in SweetTrac1 but not in SweetTrac2 when expressed with SWEET1, suggesting it may be a competitive inhibitor rather than a transported substrate .

  • Radiolabeled substrate transport: For definitive confirmation of transport, use radiolabeled versions of candidate substrates to directly measure cellular uptake .

  • Growth-based assays: For substrates with effects on cell physiology, assess whether their presence affects growth in cells expressing SWEET1 compared to controls .

Comparative Analysis with Other Transporters:

  • Side-by-side testing: Express multiple transporters (e.g., SWEET1, GLUT1, SGLT1) in the same cellular system and compare transport/binding profiles across identical substrate panels.

  • Chimeric protein approaches: Create chimeric transporters by swapping domains between SWEET1 and other sugar transporters to identify regions responsible for substrate specificity differences.

Structure-Function Analysis:

  • Mutagenesis of binding pocket residues: Target residues in the substrate-binding pocket to identify those critical for specific substrate recognition. Sequence comparison and mutagenesis analysis have revealed that differences in affinity depend on nonspecific interactions involving previously uncharacterized residues in the substrate-binding pocket .

  • Molecular docking simulations: Use computational approaches to predict binding modes of various substrates and compare binding energies.

Kinetic Parameter Comparison:

  • Affinity measurements: Determine Km values for various substrates to create a comprehensive affinity profile for SWEET1.

  • Transport rate analysis: Measure Vmax values to understand the maximum transport rates for different substrates.

CompoundSWEET1 TransportSWEET1 Affinity (est. Km)GLUT1 TransportSGLT1 Transport
D-glucoseYesMediumYes (high affinity)Yes (high affinity)
D-fructoseYesMediumYes (lower affinity)No
D-mannoseYesMediumYes (medium affinity)No
1-deoxynojirimycinYesLowNoNo
VogliboseYesLowNoNo
1-thio-D-glucoseYesLowLimitedNo

This multifaceted approach not only reveals the unique substrate profile of SWEET1 but also provides insights into structural determinants of specificity that distinguish it from other sugar transporter families.

What is the current understanding of SWEET1's role in doxorubicin resistance, and how can this be experimentally investigated?

Recent research has revealed a potential role for SLC50A1 in modulating doxorubicin sensitivity in hepatocellular carcinoma, opening an important avenue for cancer research:

Current Understanding:

  • SLC50A1 has been found to be significantly upregulated in hepatocellular carcinoma (HCC), correlating with unfavorable prognosis in patients .

  • Gene Set Enrichment Analysis (GSEA) has identified associations between SLC50A1 expression and several signaling pathways, including KANG_DOXORUBICIN_RESISTANCE_UP, suggesting a role in chemoresistance mechanisms .

  • Experimental evidence indicates that SLC50A1 enhances resistance of HCC cells to doxorubicin (DOX) as well as 2-deoxyglucose (2-DG), linking its function to both conventional chemotherapy and metabolic therapy resistance .

  • The mechanism may involve SLC50A1's ability to regulate cellular glycolysis and the cell cycle, promoting proliferation while reducing apoptosis in cancer cells .

Experimental Investigation Approaches:

  • Genetic Modulation Studies:

    • CRISPR/Cas9 knockout models: Generate SLC50A1-deficient cancer cell lines to assess changes in doxorubicin sensitivity.

    • Inducible expression systems: Create cell lines with tunable SLC50A1 expression to examine dose-dependent effects on drug resistance.

    • Rescue experiments: Reintroduce wild-type or mutant SLC50A1 into knockout cells to identify critical domains for the resistance phenotype.

  • Mechanistic Investigations:

    • Metabolic profiling: Measure changes in glycolytic parameters (glucose uptake, lactate production, extracellular acidification rate) in SLC50A1-modulated cells treated with doxorubicin.

    • Cellular drug accumulation: Quantify intracellular doxorubicin levels using flow cytometry or fluorescence microscopy to determine if SLC50A1 affects drug uptake or efflux.

    • DNA damage response: Assess markers of DNA damage repair efficiency (γH2AX foci, comet assay) to determine if SLC50A1 enhances repair mechanisms following doxorubicin treatment.

    • Apoptosis pathways: Investigate whether SLC50A1 alters pro-survival pathways (Bcl-2, Bcl-XL) or apoptotic markers (cleaved caspase-3, PARP) in response to doxorubicin.

  • Signaling Pathway Analyses:

    • Pathway interaction studies: Investigate connections between SLC50A1 and METTL3, as a correlation between their expression has been observed in HCC .

    • Phosphoproteomic analysis: Identify alterations in signaling cascades activated by doxorubicin treatment in the presence or absence of SLC50A1.

    • Transcriptional profiling: Perform RNA-Seq to identify gene expression changes associated with SLC50A1-mediated doxorubicin resistance.

  • Translational Approaches:

    • Patient-derived models: Correlate SLC50A1 expression in patient-derived xenografts or organoids with doxorubicin response.

    • Clinical sample analysis: Retrospectively analyze SLC50A1 expression in tumor samples from patients who received doxorubicin-based treatment, correlating with treatment outcomes.

    • Combination therapy testing: Evaluate whether inhibiting SLC50A1 can sensitize resistant cells to doxorubicin, potentially identifying new therapeutic strategies.

  • Preclinical Validation:

    • In vivo models: Develop mouse models with manipulated SLC50A1 expression to evaluate doxorubicin sensitivity in a physiologically relevant context.

    • Pharmacological inhibition: Screen for or develop small molecule inhibitors of SLC50A1 to test their ability to reverse doxorubicin resistance.

These multifaceted approaches can provide comprehensive insights into the role of SWEET1/SLC50A1 in doxorubicin resistance and potentially identify new strategies to overcome chemoresistance in cancer.

How can biosensor-based approaches like SweetTrac be adapted for studying mouse SWEET1?

Biosensor-based approaches, particularly the SweetTrac system developed for plant SWEET proteins, offer powerful tools that can be adapted for studying mouse SWEET1 with several strategic modifications:

Biosensor Design Principles for Mouse SWEET1:

  • Fusion Protein Engineering:

    • Fluorophore selection: Choose conformation-sensitive fluorescent proteins (like cpGFP variants) that maintain stability under mammalian physiological conditions.

    • Insertion sites: Identify optimal sites within mouse SWEET1 for fluorophore insertion based on:

      • Predicted conformational changes during transport cycle

      • Structural homology to Arabidopsis SWEET proteins where successful insertions were made

      • Regions less likely to disrupt function (using sequence conservation analysis)

    • Linker optimization: Test various linker sequences to ensure proper folding while maintaining sensitivity to conformational changes.

  • Expression System Considerations:

    • Heterologous systems: Initially validate the biosensor in simplified systems like yeast (similar to SweetTrac1/2), which lack endogenous hexose transporters .

    • Mammalian cell adaptation: Optimize codon usage and expression conditions for subsequent testing in mouse cell lines.

    • Subcellular targeting: Include appropriate signal sequences to target the biosensor to relevant compartments (plasma membrane, Golgi) where mouse SWEET1 naturally functions.

  • Calibration and Validation:

    • Known substrate testing: Validate the biosensor with established SWEET1 substrates (D-glucose, D-fructose, D-mannose) to ensure proper functionality .

    • Dose-response characterization: Determine sensitivity range by testing fluorescence responses to various substrate concentrations.

    • Control constructs: Generate transport-deficient mutants to distinguish binding from transport events.

    • Parallel transport assays: Validate biosensor responses using conventional transport assays with radiolabeled substrates.

Advanced Applications for Mouse SWEET1 Research:

  • High-throughput Substrate Screening:

    • Custom library testing: Similar to approaches with SweetTrac1, screen custom libraries of natural and synthetic carbohydrates to identify novel substrates or inhibitors of mouse SWEET1 .

    • Automated microplate analysis: Develop protocols for high-throughput fluorescence measurements in multi-well formats to rapidly assess multiple compounds.

  • Real-time Dynamics in Live Cells:

    • Confocal microscopy: Monitor dynamic changes in biosensor fluorescence in response to substrate addition or removal in real-time.

    • FRET-based enhancements: Incorporate additional fluorophores for Förster Resonance Energy Transfer to improve signal-to-noise ratio and spatial resolution.

  • Structure-Function Analysis:

    • Mutagenesis studies: Create biosensor variants with mutations in potential substrate-binding regions to map the binding pocket of mouse SWEET1.

    • Inhibitor screening: Identify compounds that block conformational changes or substrate binding using the biosensor as a readout.

  • Physiological Studies:

    • Subcellular compartment-specific sensors: Develop variants targeted to different cellular locations to understand compartment-specific transport activities.

    • In vivo applications: Adapt the biosensor for use in transgenic mouse models to monitor SWEET1 activity in intact tissues.

Adaptation AspectSweetTrac for Plant SWEETModified SweetTrac for Mouse SWEET1
Expression systemYeastInitially yeast, then mammalian cells
TemperatureRoom temperature37°C (mammalian physiological)
pH optimumPlant cellular pHMammalian cellular pH (7.2-7.4)
Subcellular targetingPlant plasma membraneMouse plasma membrane, Golgi apparatus
Detection methodFluorescence spectroscopyFluorescence microscopy, flow cytometry
Known substratesPlant sugarsD-glucose, D-fructose, D-mannose, etc.

By adapting the SweetTrac approach to mouse SWEET1, researchers can gain unprecedented insights into the dynamics, specificity, and regulation of this important sugar transporter in real-time and in physiologically relevant contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.