Recombinant Mouse Sulfhydryl oxidase 1 (Qsox1)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Characteristics of Recombinant Mouse QSOX1

Recombinant Mouse Sulfhydryl Oxidase 1 (QSOX1) is a E. coli-derived enzyme engineered for research and therapeutic applications. It spans residues Ser36 to Ala550, includes an N-terminal Met and 6-His tag, and achieves >95% purity . The protein lacks a carrier protein (e.g., BSA), making it suitable for assays where interference from additives is a concern .

Key Features

PropertyDetail
SourceE. coli expression system
IsoformTruncated version lacking the C-terminal transmembrane domain
FunctionCatalyzes disulfide bond formation and dithiol/disulfide exchange
Enzymatic ActivityOxidizes thiols to disulfides, reducing molecular oxygen to H₂O₂

Isoform Comparison

IsoformLengthTransmembrane DomainTissue Distribution
QSOX1-S604 aaAbsentSecreted (e.g., Golgi, blood)
QSOX1-L747 aaPresentMembrane-bound (e.g., ER)

The flexible linker between domains enables cooperative redox shuttling .

Role in Protein Folding and Stress Responses

QSOX1 cooperates with protein disulfide isomerase (PDI) to oxidize unfolded thiols in the ER/Golgi, promoting proper protein folding . In breast cancer, oxidative stress induces QSOX1 expression, protecting cells against apoptosis .

Cancer Progression and Dormancy

  • Invasion and Metastasis: QSOX1 enhances MMP-9 activity, promoting breast cancer cell invasion .

  • Dormant Cancer Stem Cells (DCSCs): QSOX1-rich niches in esophageal cancer elevate PD-L1, enabling immune evasion. Inhibiting QSOX1 (e.g., with Ebselen) synergizes with anti-PD-1 therapy to eradicate DCSCs .

Mucosal Barrier Maintenance

QSOX1 regulates glycosyltransferase sialylation in colonic goblet cells. Knockout mice exhibit defective mucus assembly and colitis susceptibility due to reduced sialic acid content .

Enzymatic Activity Assay Protocol

Reagents:

  • Substrate: DTT, HRP, Amplex® Ultra Red (AUR)

  • Buffer: 50 mM Sodium Phosphate, pH 7.5

Procedure:

  1. Preparation: Dilute rmQSOX1 to 1 ng/μL in assay buffer.

  2. Reaction: Mix rmQSOX1 (50 μL) with substrate mixture (100 μM AUR, 2 U/mL HRP, 300 μM DTT).

  3. Detection: Monitor fluorescence (544 nm excitation/590 nm emission) for 5 minutes.

Calculation:

Specific Activity (pmol/min/µg)=Adjusted Vmax×Conversion FactorEnzyme Amount (µg)\text{Specific Activity (pmol/min/µg)} = \frac{\text{Adjusted V}_{\text{max}} \times \text{Conversion Factor}}{\text{Enzyme Amount (µg)}}

Conversion Factor: Derived from H₂O₂ standard curve .

Therapeutic and Research Applications

ApplicationMechanismOutcome
Cancer TherapyInhibit QSOX1 to block PD-L1 upregulation and MMP-9 activity Enhanced CD8+ T-cell infiltration
Mucosal Barrier StudiesAnalyze sialylation defects in QSOX1-deficient models Identify colitis risk factors
Protein Folding AssaysMonitor disulfide bond formation in ER/Golgi Validate folding efficiency

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Qsox1; Qscn6; Sox; Sulfhydryl oxidase 1; mSOx; Quiescin Q6; Skin sulfhydryl oxidase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-748
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Qsox1
Target Protein Sequence
ARLSVLYSSSDPLTLLDADSVRPTVLGSSSAWAVEFFASWCGHCIAFAPTWKELANDVKD WRPALNLAVLDCAEETNSAVCREFNIAGFPTVRFFQAFTKNGSGATLPGAGANVQTLRMR LIDALESHRDTWPPACPPLEPAKLNDIDGFFTRNKADYLALVFEREDSYLGREVTLDLSQ YHAVAVRRVLNTESDLVNKFGVTDFPSCYLLLRNGSVSRVPVLVESRSFYTSYLRGLPGL TRDAPPTTATPVTADKIAPTVWKFADRSKIYMADLESALHYILRVEVGKFSVLEGQRLVA LKKFVAVLAKYFPGQPLVQNFLHSINDWLQKQQKKRIPYSFFKAALDSRKEDAVLTEKVN WVGCQGSEPHFRGFPCSLWVLFHFLTVQANRYSEAHPQEPADGQEVLQAMRSYVQFFFGC RDCADHFEQMAAASMHQVRSPSNAILWLWTSHNRVNARLSGALSEDPHFPKVQWPPRELC SACHNELNGQVPLWDLGATLNFLKAHFSPANIVIDSSASRHTGRRGSPEATPELVMDTLK LESRNSVLGHEQAASAESPGATALDVPAEKPEASGPQELYTGLRMGGASPGQGPPERMED HQRDMQENAPGQQHLSKRDTEALFLPEVNHLQGPLELRRGGRSPKQLAPILEEEPEALAI QGQGQWLQVLGGGISHLDISLCVGLYSVSFMGLLAMYTYFRARLRTPKGHASYPTA
Uniprot No.

Target Background

Function
Recombinant Mouse Sulfhydryl oxidase 1 (Qsox1) catalyzes the oxidation of peptide and protein thiol groups to disulfides, concomitantly reducing oxygen to hydrogen peroxide. It plays a crucial role in disulfide bond formation in numerous extracellular proteins. In fibroblasts, Qsox1 is essential for the proper incorporation of laminin into the extracellular matrix, thereby supporting normal cell-cell adhesion and migration.
Gene References Into Functions
  1. Elevated serum thioredoxin reductase levels in mice with hepatocellular carcinoma are significantly inhibited by serum QSOX1. PMID: 27581528
  2. QSOX1 inhibits autophagy in breast cancer cells. PMID: 24475161
  3. Crystal structure of QSOX1. PMID: 22801504
  4. Characterization of a skin SOx cDNA as a disulfide cross-linking enzyme. PMID: 12354420
  5. High QSOX1 expression in seminiferous tubules suggests a key physiological role in sperm function and potential as a marker for male infertility diagnosis. PMID: 16160860
Database Links
Protein Families
Quiescin-sulfhydryl oxidase (QSOX) family
Subcellular Location
[Isoform 1]: Golgi apparatus membrane; Single-pass membrane protein. Secreted.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.; [Isoform 4]: Secreted.
Tissue Specificity
Detected in skin (at protein level). Expressed in the seminal vesicles and skin.

Q&A

What is the molecular structure of mouse QSOX1 and how does it relate to its function?

Mouse QSOX1 is a homodimeric enzyme composed of two identical subunits, each containing distinct domains that contribute to its function. The protein contains a thioredoxin-like domain and a flavin adenine dinucleotide (FAD)-binding domain. The thioredoxin-like domain is responsible for the catalytic activity, while the FAD-binding domain participates in redox reactions. The enzyme features a compact globular structure with the active site positioned at the interface of the two subunits. This active site contains a highly conserved CXXC motif critical for catalyzing the oxidation of thiol groups to form disulfide bonds . The evolutionary history of QSOX1 is notable as it results from an ancient gene fusion between thioredoxin (TRX) and ERV1, a yeast sulfhydryl oxidase . This structural arrangement enables QSOX1 to efficiently catalyze disulfide bond formation while reducing molecular oxygen to hydrogen peroxide.

What are the primary enzymatic activities of mouse QSOX1?

Mouse QSOX1 exhibits two principal enzymatic activities:

  • Sulfhydryl oxidase activity: QSOX1 catalyzes the oxidation of free thiols (sulfhydryl groups) to form disulfide bonds, a process essential for proper protein folding and stability. The enzyme demonstrates broad substrate specificity, capable of oxidizing diverse proteins with varying structures and functions .

  • Disulfide bond formation activity: Beyond simple oxidation, QSOX1 facilitates electron transfer from reduced glutathione (GSH) to newly formed disulfide bonds, generating oxidized glutathione (GSSG). This redox reaction is crucial for maintaining cellular redox balance and supporting various cellular processes .

These enzymatic functions make QSOX1 particularly valuable in protein folding studies and recombinant protein production, especially for proteins requiring disulfide bonds for their structural integrity and function.

How can I establish a reliable assay for measuring mouse QSOX1 activity?

A fluorescence-based coupled enzyme assay is recommended for reliable measurement of mouse QSOX1 activity. The following protocol can be implemented:

Materials required:

  • Assay Buffer: 50 mM Sodium Phosphate, pH 7.5

  • Recombinant Mouse QSOX1/Quiescin Q6

  • Coupling Enzyme: Horseradish Peroxidase (HRP), 250-330 U/mg

  • Substrate Component 1: Dithiothreitol (DTT), 1 M stock in deionized water

  • Substrate Component 2: Amplex Ultra Red (AUR), 10 mM stock in DMSO

  • F15 Black Maxisorp Plate

  • Fluorescent Plate Reader

Procedure:

  • Dilute recombinant mouse QSOX1 to 1 ng/μL in Assay Buffer

  • Prepare a Substrate Mixture containing DTT and AUR

  • Mix QSOX1, HRP, and the Substrate Mixture in appropriate ratios

  • Monitor fluorescence over time using a plate reader

  • Calculate enzymatic activity based on the rate of fluorescence increase

This assay works on the principle that QSOX1 oxidizes DTT, producing hydrogen peroxide, which is then utilized by HRP to oxidize Amplex Ultra Red to a fluorescent product. The fluorescence intensity directly correlates with QSOX1 enzymatic activity.

What are the optimal storage conditions for maintaining recombinant mouse QSOX1 stability?

For optimal stability of recombinant mouse QSOX1:

  • Store the protein in a manual defrost freezer and avoid repeated freeze-thaw cycles

  • Upon receipt, immediately store the protein at the recommended temperature

  • The protein is typically supplied as a 0.2 μm filtered solution in Tris and NaCl

  • Carrier-free preparations (without BSA) are available for applications where BSA might interfere

  • For long-term storage, aliquot the protein to minimize freeze-thaw cycles

When working with carrier-free preparations, extra care should be taken as the absence of carrier proteins like BSA may reduce stability during handling. Addition of stabilizing proteins or cryoprotectants may be beneficial for long-term storage of dilute solutions.

How does QSOX1 expression vary across different cancer types, and what are the implications?

QSOX1 has been found to be overexpressed in several cancer types with significant clinical implications:

The expression pattern appears to be associated with tumor grade and molecular subtype. In breast cancer, stronger QSOX1 protein expression correlates with higher-grade tumors that are ER-positive and Her-2 and cytokeratin 5/6 negative . These findings suggest that QSOX1 may serve as an independent predictor of clinical outcome in certain cancer types, potentially through its influence on tumor cell invasion and migration at the tumor-stroma interface .

What is the emerging consensus on QSOX1's role in tumor cell invasion?

A growing consensus suggests that QSOX1 overexpression plays a significant role in tumor cell invasion, particularly at the tumor-stroma interface. The current understanding indicates that:

  • QSOX1 facilitates tumor cell migration, potentially through modulation of extracellular matrix components

  • It may serve as a prognostic indicator of metastatic potential

  • Its presence could be an indicator that cancer is present in a host

  • The enzymatic activity of QSOX1 may provide advantages to tumor cells during invasion processes

How do we reconcile the contradictory findings regarding QSOX1 as a marker of poor versus favorable prognosis in breast cancer?

The literature presents contradictory findings regarding QSOX1's prognostic value in breast cancer:

To reconcile these findings, researchers should consider:

  • Molecular subtyping: QSOX1's role may differ across molecular subtypes of breast cancer

  • Methodological differences: Discrepancies in IHC techniques, cell line authentication, and experimental controls

  • Context-dependent functions: QSOX1 may have different roles depending on the tumor microenvironment

  • Isoform-specific effects: Different QSOX1 isoforms might have distinct functions

Future research should carefully control for these variables and consider comprehensive molecular profiling alongside functional studies to clarify these contradictions .

How might QSOX1-produced hydrogen peroxide influence tumor microenvironment and genetic stability?

QSOX1 enzymatic activity generates hydrogen peroxide as a byproduct, creating an oxidative microenvironment with significant implications for tumor biology:

  • Generation of reactive oxygen species (ROS): QSOX1 overexpression creates a highly oxidative cellular environment containing ROS, particularly hydrogen peroxide

  • Triggering antioxidant responses: This oxidative environment induces production of glutathione/glutathione reductase, thioredoxin reductase, and superoxide dismutase

  • DNA damage potential: ROS can cause adducts in DNA, potentially leading to genomic mutations, especially when DNA repair mechanisms are compromised

  • Cellular signaling effects: ROS affects multiple cellular functions including:

    • Transcription factor activation

    • Intracellular signaling pathway modulation

    • Cell cycle regulation

    • Motility alterations

    • Anoikis (detachment-induced cell death) resistance

Tumor cells can exploit this oxidative environment for survival advantage. Oxidation activates pro-growth signaling molecules such as Src, Akt, and Erk kinases, driving cell survival and helping escape death pathways. For example, oxidatively activated Src enables ligand-independent phosphorylation of EGFR, triggering downstream activation of ERK and Akt, which are pro-survival signals. These activated kinases can constitutively phosphorylate pro-apoptotic proteins like Bim, leading to their proteasomal degradation and promoting tumor cell survival .

What are the key specifications of commercially available recombinant mouse QSOX1?

When selecting recombinant mouse QSOX1 for research applications, consider the following specifications:

CharacteristicSpecificationNotes
OriginE. coli-derived mouse QSOX1/Quiescin Q6 proteinProkaryotic expression system
SequenceSer36-Ala550 with N-terminal Met and 6-His tagIncludes key functional domains
Molecular WeightApproximately 26.81 kDaMay vary depending on tag and formulation
Formulation0.2 μm filtered solution in Tris and NaClAvailable with or without carrier protein
StorageManual defrost freezer, avoid freeze-thaw cyclesCritical for maintaining activity

Researchers should consider whether to use carrier-free (CF) or BSA-containing preparations based on their specific application. The carrier-free version is recommended for applications where BSA could interfere with experimental results, while the BSA-containing version is generally advised for cell or tissue culture applications and as ELISA standards due to enhanced stability and shelf-life .

How can QSOX1 be effectively applied in protein folding studies and recombinant protein production?

QSOX1 has valuable applications in both basic research and biotechnology:

  • Protein folding studies:

    • Use QSOX1 to investigate the role of disulfide bond formation in protein folding kinetics

    • Apply QSOX1 in combination with protein disulfide isomerase (PDI) to study cooperative folding pathways

    • Employ QSOX1 to examine the stability of various proteins including antibodies, enzymes, and growth factors

  • Recombinant protein production:

    • Add QSOX1 to production processes to improve yield and quality of disulfide-rich proteins

    • Particularly valuable for therapeutic proteins like antibodies and enzymes

    • Can enhance correct folding of complex proteins in heterologous expression systems

  • Methodological considerations:

    • Optimize QSOX1:substrate ratios based on the complexity of target proteins

    • Consider redox buffer conditions to maximize proper disulfide formation

    • Monitor hydrogen peroxide production as an indicator of QSOX1 activity

    • For proteins with multiple disulfide bonds, consider combining QSOX1 with PDI to ensure correct pairing

Despite QSOX1's broad substrate specificity, it's important to note that it does not efficiently interact with PDI as a substrate, suggesting selective substrate preferences that should be considered when designing experimental approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.