Recombinant Mouse SUN domain-containing protein 2 (Sun2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
Sun2; Unc84b; SUN domain-containing protein 2; Protein unc-84 homolog B; Sad1/unc-84 protein-like 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-731
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSRRSQRLTRYSQDDNDGGSSSSGASSVAGSQGTVFKDSPLRTLKRKSSNMKHLSPAPQL GPSSDSHTSYYSESVVRESYIGSPRAVSLARSALLDDHLHSEPYWSGDLRGRRRRGTGGS ESSKANGLTAESKASEDFFGSSSGYSSEDDLAGYTDSDQHSSGSRLRSAASRAGSFVWTL VTFPGRLFGLLYWWIGTTWYRLTTAASLLDVFVLTRSRHFSLNLKSFLWFLLLLLLLTGL TYGAWHFYPLGLQTLQPAVVSWWAAKESRKQPEVWESRDASQHFQAEQRVLSRVHSLERR LEALAADFSSNWQKEAIRLERLELRQGAAGHGGGSSLSHEDALSLLEGLVSRREATLKED LRRDTVAHIQEELATLRAEHHQDSEDLFKKIVQASQESEARVQQLKTEWKSMTQEAFQES SVKELGRLEAQLASLRQELAALTLKQNSVADEVGLLPQKIQAARADVESQFPDWIRQFLL GDRGARSGLLQRDEMHAQLQELENKILTKMAEMQGKSAREAAASLGQILQKEGIVGVTEE QVHRIVKQALQRYSEDRIGMVDYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQ SPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDF AIFGFDEDLQQEGTLLGTFAYDQDGEPIQTFYFQASKMATYQVVELRILTNWGHPEYTCI YRFRVHGEPAH
Uniprot No.

Target Background

Function
As a component of the LINC (Linker of Nucleoskeleton and Cytoskeleton) complex, SUN domain-containing protein 2 (Sun2) mediates the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions facilitated by the LINC complex are crucial for transmitting mechanical forces across the nuclear envelope and regulating nuclear movement and positioning. Specifically, SYNE2 and SUN2 form arrays of transmembrane actin-associated nuclear (TAN) lines, which bind to F-actin cables and couple the nucleus to retrograde actin flow during actin-dependent nuclear movement. Sun2 is essential for interkinetic nuclear migration (INM), nucleokinesis, and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and glial migration. It plays a critical role in nuclear migration in retinal photoreceptor progenitors, likely through interaction with cytoplasmic dynein-dynactin and kinesin motor complexes, and possibly B-type lamins; SUN1 and SUN2 appear to exhibit functional redundancy. The SUN1/2:KASH5 LINC complex links telomeres to microtubules during meiosis, with SUN1 and SUN2 showing at least partial redundancy. Sun2 anchors chromosome movement in meiotic prophase and participates in the selective gene expression of coding and non-coding RNAs essential for gametogenesis. It is required for telomere attachment to the nuclear envelope and gametogenesis. Sun2 may also function on endocytic vesicles as a Rab5-GDP receptor, potentially involved in Rab5 activation.
Gene References Into Functions
  1. Sun2 plays a role in the DNA damage response. PMID: 22863315
  2. Sun2 is a component of a membrane-spanning fibrillar complex that interconnects attached telomeres with cytoplasmic structures. PMID: 17452644
  3. Studies indicate that SUN2-KASH complexes mediate the coupling between the nucleus and the centrosome, serving as nuclear envelope anchors for cytoplasmic dynein/dynactin during neuronal migration. PMID: 19874786
Database Links
Subcellular Location
Nucleus inner membrane; Single-pass type II membrane protein. Nucleus envelope. Endosome membrane; Single-pass type II membrane protein.
Tissue Specificity
Highly expressed in heart, placenta and muscle.

Q&A

What is Mouse Sun2 and what are its primary cellular functions?

Sun2 (unc-84 homolog B) is a transmembrane protein that functions as a key component of the LINC complex, which connects the nuclear lamina with the cytoskeleton. It plays crucial roles in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. The nucleocytoplasmic interactions established by Sun2 within the LINC complex are essential for nuclear migration, positioning, and cellular mechanics .

As a component of transmembrane actin-associated nuclear (TAN) lines, Sun2 coordinates with SYNE2 to couple the nucleus to retrograde actin flow during actin-dependent nuclear movement. It is required for interkinetic nuclear migration and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration .

During meiosis, Sun2 forms part of the SUN1/2:KASH5 LINC complex that couples telomeres to microtubules, anchors chromosome movement in meiotic prophase, and is involved in selective gene expression needed for gametogenesis .

What is the molecular structure and typical properties of recombinant Mouse Sun2?

Recombinant Mouse Sun2 protein has the following characteristics:

PropertyDescription
Molecular Mass52.6 kDa
SourceTypically expressed in HEK293 cells
Common TagsDDK and Myc tags
Purity>80% as determined by SDS-PAGE and Coomassie blue staining
DomainsContains the conserved SUN domain

The coding sequence of mouse Sun2 encompasses amino acids 1 to 473, and the SUN domain is located at amino acids 569 to 730 . For cloning purposes, researchers have successfully used the following primers:

  • Forward: 5′-TAGCTGTACAAGATGTCGAGACGAAGCC-3′

  • Reverse: 5′-ACTAAGCTTAGTAGGGCTCTGGGTACTT-3′

How is Sun2 expressed and localized during different cellular processes?

Sun2 shows distinct expression and localization patterns depending on cellular context:

In somatic cells, Sun2 is homogeneously distributed throughout the nuclear envelope (NE) as an inner nuclear membrane (INM) protein. It contains an N-terminal nucleoplasmic domain that binds nuclear lamins and a C-terminus with the conserved SUN domain that extends into the perinuclear space .

During meiosis, Sun2 shows remarkably different behavior, localizing exclusively to the attachment sites of telomeres. This specific Sun2-telomere association appears as early as leptotene stage and is maintained throughout the dynamic movement of chromosomal ends. The association does not require the assembly of chromosomal axial elements or the presence of A-type lamins .

In cells undergoing mitosis, Sun2 localizes to polar regions of the mitotic spindle. Its expression levels change depending on extracellular matrix (ECM) stiffness, with cells dividing on soft ECM showing lower levels of Sun2 expression compared to those on stiffer substrates .

What methods are used to study Sun2 localization in cells?

Researchers employ several techniques to study Sun2 localization:

Immunofluorescence Microscopy:
Standard immunofluorescence protocols can be used to detect Sun2 in both somatic and meiotic cells. For meiotic cells, specialized protocols for examining spread chromosomes are recommended to visualize the association of Sun2 with telomeres .

Electron Microscopy (EM) with Immunogold Labeling:
This technique provides high-resolution localization of Sun2. The protocol involves:

  • Fixation of mouse testes in 2.5% cacodylate buffered glutaraldehyde (1h, 4°C)

  • Post-fixation with 1% osmium tetroxide (1h)

  • Overnight staining with 0.5% uranyl acetate

  • Dehydration in ethanol series and embedding in Epon

For immunogold localization specifically:

  • Process testis cryosections similar to immunofluorescence protocols

  • Use Fluoro Nanogold-anti-rabbit as secondary antibody

  • Refix in 2% glutaraldehyde in PBS

  • Apply silver enhancement using an appropriate kit (e.g., Aurion R-GENT SE-EM Kit)

  • Dehydrate and embed in Epon

  • Create ultrathin sections and stain with uranyl acetate and lead citrate

How can researchers manipulate Sun2 expression in experimental systems?

Several approaches can be used to manipulate Sun2 expression:

siRNA-mediated Knockdown:
Sun2 can be efficiently depleted using siRNA transfection. Multiple distinct siRNAs targeting Sun2 are recommended to confirm specificity of observed phenotypes .

Rescue Experiments:
To confirm the specificity of Sun2 knockdown phenotypes, rescue experiments can be performed:

  • Silence Sun2 expression for 48h

  • Wash cells with PBS

  • Transfect cells for 24h with a Sun2 expression plasmid (e.g., DS-SUN2-GFP)

  • Use a control plasmid (e.g., pmaxGFP) in parallel

  • Transfection can be performed using Lipofectamine 2000 following manufacturer's instructions

Molecular Cloning for Expression Constructs:
For expressing tagged versions of Sun2:

  • Amplify the coding sequence of mouse Sun2 by PCR using specific primers

  • Clone the PCR product into appropriate expression vectors (e.g., pEGFP-C1 vector using BrsGI and HindIII restriction sites)

  • Create truncated versions as needed for domain-specific studies

How does Sun2 regulate mitotic duration in response to extracellular matrix properties?

Sun2 plays a critical role in regulating mitotic progression in response to extracellular matrix (ECM) stiffness. The mechanism involves:

  • ECM Mechanosensing: Cells on soft ECM express lower levels of Sun2 compared to cells on stiff substrates.

  • Metaphase Duration Regulation:

    • Depletion of Sun2 by siRNA results in delayed metaphase and anaphase onset.

    • This phenocopies the behavior of cells dividing on soft ECM.

    • The delay specifically affects metaphase without influencing other mitotic phases .

  • Spindle Morphology Effects:

    • Sun2 knockdown causes an increased length of mitotic spindle interpolar microtubules.

    • Cells depleted of Sun2 show fewer astral microtubules.

    • These defects activate the spindle assembly checkpoint (SAC), as evidenced by an increased number of MAD2-positive kinetochores in metaphase .

  • CYLD-dependent Mechanism:

    • Sun2 interacts with the deubiquitinase CYLD specifically during mitosis.

    • CYLD promotes microtubule stability through its three Cap-Gly domains.

    • Sun2 depletion leads to decreased CYLD expression during mitosis but not interphase.

    • This mechanism provides a molecular link between ECM stiffness sensing and mitotic duration .

What is the role of Sun2 in meiotic telomere dynamics?

Sun2 serves as a crucial component of the meiotic telomere attachment complex:

  • Telomere Tethering:

    • Sun2 specifically localizes to the nuclear envelope (NE) attachment sites of meiotic telomeres.

    • This localization begins at the leptotene stage and persists throughout the dynamic movement of telomeres.

    • Sun2 functions as a constitutive component of the meiotic attachment complex that structurally links telomeres to the NE .

  • Chromosomal Bouquet Formation:

    • Dynamic repositioning of telomeres is a highly conserved feature of meiotic prophase I.

    • On entry into meiosis, telomeres attach to the nuclear envelope and transiently cluster at a limited area to form a chromosomal bouquet.

    • This clustering is thought to promote chromosome recognition and stable pairing of homologs.

    • Sun2 plays a central role in this process by mediating the attachment of telomeres to the NE .

  • Nucleocytoplasmic Bridge Formation:

    • Electron microscopy studies reveal that Sun2 is concentrated at membrane-spanning fibrillar complexes.

    • These complexes connect telomeres along the inner nuclear surface, traverse the perinuclear space, and radiate into the cytoplasm.

    • Sun2 appears to be a central component of these previously observed but molecularly uncharacterized filaments .

  • Evolutionary Conservation:

    • The involvement of SUN-domain proteins in meiotic telomere dynamics appears to be evolutionarily conserved across eukaryotes.

    • Similar mechanisms have been observed in fission yeast, suggesting deep conservation of this critical meiotic process .

How does the interaction between Sun2 and CYLD affect astral microtubule formation?

The interaction between Sun2 and CYLD provides a molecular mechanism for regulating astral microtubule dynamics:

  • Mitosis-Specific Interaction:

    • Sun2 interacts with CYLD specifically during mitosis but not during interphase.

    • This interaction can be detected through immunoprecipitation of Sun2 in cells synchronized with STC (synchronization techniques) .

  • CYLD Function in Microtubule Stability:

    • CYLD is a deubiquitinase containing three Cap-Gly domains in its amino terminus.

    • These domains promote microtubule stability.

    • CYLD localizes to the polar regions of the mitotic spindle, similar to Sun2 .

  • Effect of Sun2 on CYLD Expression:

    • Sun2-depleted cells display decreased CYLD expression specifically during mitosis.

    • This effect is not observed during interphase.

    • SUN1 depletion, in contrast, has no effect on CYLD expression, highlighting the specificity of the Sun2-CYLD relationship .

  • ECM Stiffness Effects:

    • CYLD expression is decreased in cells undergoing mitosis on soft ECM compared to more rigid substrates.

    • Inhibition of CYLD does not affect Sun2 expression, suggesting a unidirectional relationship .

  • Consequence for Mitotic Progression:

    • Low levels of Sun2 expression (due to siRNA-mediated depletion or adhesion on soft ECM) lead to a decrease in CYLD during mitosis.

    • This causes astral microtubule defects and metaphase delay.

    • While evidence supports this mechanistic connection, additional mechanisms may also contribute to the regulation of astral microtubule dynamics by Sun2 .

What are the current limitations in Sun2 research and how might they be addressed?

Current limitations in Sun2 research include:

  • Redundancy with Other SUN-domain Proteins:

    • Sun1 and Sun2 appear to act at least partially redundantly in several contexts.

    • This functional overlap complicates the interpretation of single-gene knockout or knockdown experiments.

    • Future research should consider using double knockdown/knockout approaches to bypass potential compensatory mechanisms .

  • Tissue-Specific Functions:

    • Sun2 may have different roles in various tissues and developmental contexts.

    • Most studies have focused on limited cell types or contexts.

    • Broader investigations across diverse cell types and developmental stages would provide a more comprehensive understanding of Sun2 functions .

  • Mechanistic Gaps:

    • While associations between Sun2 and various cellular processes have been identified, detailed molecular mechanisms remain incompletely understood.

    • Advanced proteomics approaches to identify the complete interactome of Sun2 during different cellular processes would help address this limitation .

How might understanding Sun2 function contribute to broader biological questions?

Understanding Sun2 function has implications for several fundamental biological processes:

  • Nuclear-Cytoskeletal Communication:

    • Sun2's role in the LINC complex provides insights into how forces are transmitted between the cytoskeleton and nucleus.

    • This has implications for understanding mechanobiology and cellular responses to physical forces .

  • Meiotic Chromosome Dynamics:

    • Sun2's involvement in telomere attachment during meiosis illuminates mechanisms of chromosomal movement essential for proper homologous recombination.

    • This contributes to our understanding of gametogenesis and factors influencing fertility .

  • Cell Division Regulation:

    • The connection between Sun2, CYLD, and mitotic progression reveals novel mechanisms by which cells integrate environmental cues (ECM stiffness) with cell division timing.

    • This has potential implications for understanding development and diseases involving dysregulated cell division .

  • Evolutionary Conservation of Nuclear Envelope Functions:

    • The conserved nature of SUN-domain proteins across eukaryotes suggests fundamental roles in nuclear organization.

    • Comparative studies across species could reveal evolutionary adaptations in nuclear envelope functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.