Recombinant Mouse Surfeit locus protein 1 (Surf1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Surf1; Surf-1; Surfeit locus protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Surf1
Target Protein Sequence
MAAVMALAVLPRRMTRWSQWAYAGRAQFCAVRRSVFGFSVRSGMVCRPRRCCSSTAETAA AKAEDDSFLQWFLLLIPATAFGLGTWQVQRRKWKLKLIAELESRVMAEPIPLPADPMELK NLEYRPVKVRGHFDHSKELYIMPRTMVDPVREARDAGRLSSTESGAHVVTPFHCSDLGVT ILVNRGFVPRKKVNPETRQKGQVLGEVDLVGIVRLTENRKPFVPENSPERNHWYYRDLEA MAKITGADPIFIDADFHSTAPGGPIGGQTRVTLRNEHMQYILTWYGLCAATSYLWFQKFV RRTPIM
Uniprot No.

Target Background

Function
Recombinant Mouse Surfeit locus protein 1 (Surf1) is a component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. It plays a crucial role in regulating cytochrome c oxidase assembly.
Gene References Into Functions

Functional Studies of Surf1:

  1. Fibroblasts from Surf1 knockout mice exhibit increased resistance to oxidative stress-induced cell death (paraquat or tert-Butyl hydroperoxide), but not hydrogen peroxide. PMID: 27208630
  2. Surf1 deficiency-induced metabolic changes may positively impact brain function. PMID: 23838831
  3. Increased expression of peroxisome proliferator-activated receptor gamma-coactivator 1-alpha (PGC-1alpha) mRNA and protein, and its target genes, observed in white adipose tissue from Surf1 knockout mice. PMID: 23241310
  4. Surf1 knockout mice exhibit increased baseline respiratory frequency and altered responses to hypoxia and hypercapnia, affecting both respiratory frequency and motor nerve discharge patterns. PMID: 21167962
  5. Murine Surf1 protein (Surf1p) is functionally linked to cytochrome c oxidase. PMID: 12566387
  6. Surf1 knockout mice show extended lifespan and complete protection against kainic acid-induced, Ca(2+)-dependent neurotoxicity. PMID: 17210671
Database Links
Protein Families
SURF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Mouse Surfeit locus protein 1 (Surf1) and where is it primarily expressed?

Mouse Surf1 is a nuclear-encoded mitochondrial protein involved in the assembly of cytochrome c oxidase (COX), which is complex IV of the electron transport chain. The protein is encoded by the Surf1 gene (also designated as Surf-1 or 0610010F23Rik in some databases) and is expressed ubiquitously across tissues, with particularly high expression in metabolically active tissues such as skeletal muscle, liver, heart, and brain . The protein functions primarily within the inner mitochondrial membrane where it facilitates the proper assembly of COX subunits.

What is the molecular structure and size of Mouse Surf1 protein?

Mouse Surf1 is a transmembrane protein containing approximately 300 amino acids with a molecular weight of approximately 30-35 kDa. The protein contains conserved domains characteristic of the SURF1 family, including transmembrane domains that anchor it to the inner mitochondrial membrane. The recombinant forms of this protein available for research purposes maintain these structural characteristics and are typically produced with >85% purity as determined by SDS-PAGE analysis .

How does Surf1 protein contribute to mitochondrial function?

Surf1 plays a critical role as an assembly factor for cytochrome c oxidase (COX). It specifically facilitates the incorporation of copper cofactors and proper folding of COX subunits during the biogenesis of the holoenzyme complex. Knockout studies have demonstrated that Surf1 deficiency leads to profound and isolated defects in COX activity in multiple tissues, particularly skeletal muscle and liver . The protein does not have catalytic activity itself but rather functions as a chaperone to ensure proper COX assembly, which is essential for cellular respiration and ATP production.

What expression systems are optimal for producing Recombinant Mouse Surf1?

Multiple expression systems have been successfully employed to produce Recombinant Mouse Surf1, including E. coli, yeast, baculovirus-infected insect cells, mammalian cell systems, and cell-free expression systems . Each system offers distinct advantages:

  • E. coli expression: Provides high yield and cost-effectiveness but may require refolding steps due to the membrane protein nature of Surf1

  • Mammalian expression systems: Offer proper post-translational modifications and folding but at lower yields

  • Cell-free expression systems: Allow for rapid production and are particularly useful for structural studies

The choice of expression system should be guided by the specific experimental requirements, with consideration of factors such as required protein folding, post-translational modifications, and intended applications.

What purification methods yield the highest quality Recombinant Mouse Surf1?

High-quality Recombinant Mouse Surf1 (≥85% purity) is typically achieved through multi-step purification protocols . An effective purification strategy often includes:

  • Initial capture using affinity chromatography (typically with His-tag or other fusion tags)

  • Intermediate purification using ion-exchange chromatography

  • Polishing step with size-exclusion chromatography

Quality control is performed using SDS-PAGE analysis, which should demonstrate ≥85% purity for research-grade applications . Western blot analysis using specific anti-Surf1 antibodies provides confirmation of identity and integrity. For membrane proteins like Surf1, the addition of appropriate detergents during purification is critical to maintain protein solubility and native conformation.

How can researchers verify the functional activity of purified Recombinant Mouse Surf1?

Functional verification of Recombinant Mouse Surf1 can be challenging as it is an assembly factor rather than an enzyme with direct catalytic activity. Effective strategies include:

  • Complementation assays: Introducing the recombinant protein into Surf1-deficient cell lines and measuring restoration of COX activity

  • Binding assays: Demonstrating specific interactions with COX subunits or other assembly factors using co-immunoprecipitation

  • Structural integrity assessment: Using circular dichroism or limited proteolysis to confirm proper folding

  • In vitro assembly assays: Monitoring the enhancement of COX assembly in reconstituted systems

These functional tests provide critical validation beyond simple purity assessment to ensure the recombinant protein maintains its native biological activity.

What are the recommended protocols for using Recombinant Mouse Surf1 in Western blot applications?

For optimal Western blot detection of Recombinant Mouse Surf1:

  • Sample preparation: Denature samples at 70°C (not boiling) for 10 minutes in standard loading buffer with reducing agent

  • Gel selection: Use 10-12% SDS-PAGE gels for optimal resolution

  • Transfer conditions: Transfer to PVDF membranes at 25V overnight at 4°C for efficient transfer of this membrane protein

  • Blocking: 5% non-fat milk in TBST for 1 hour at room temperature

  • Primary antibody: Anti-Surf1 antibodies (rabbit polyclonal recommended) at 1:1000 dilution, incubated overnight at 4°C

  • Detection: HRP-conjugated secondary antibodies with enhanced chemiluminescence detection

This protocol has been validated for detecting both endogenous and recombinant Surf1 protein with high specificity and sensitivity .

How can Recombinant Mouse Surf1 be effectively used in protein interaction studies?

To investigate protein interactions involving Recombinant Mouse Surf1:

  • Co-immunoprecipitation (Co-IP): Use anti-Surf1 antibodies conjugated to magnetic or agarose beads to pull down Surf1 and its interaction partners

  • Pull-down assays: Utilize tagged recombinant Surf1 (His, GST, or FLAG) to capture interaction partners from cell lysates

  • Crosslinking approaches: Apply mild crosslinking agents before analysis to stabilize transient interactions

  • Proximity labeling: BioID or APEX2 fusions with Surf1 can identify proximal proteins in the native mitochondrial environment

For all interaction studies, appropriate controls including tag-only proteins and non-specific antibodies are essential to confirm specificity of the identified interactions.

What considerations are important when designing immunohistochemistry experiments with Surf1 antibodies?

For successful immunohistochemistry with Surf1 antibodies:

  • Tissue fixation: Use 4% paraformaldehyde; avoid over-fixation which can mask Surf1 epitopes

  • Antigen retrieval: Heat-induced epitope retrieval in citrate buffer (pH 6.0) is typically effective

  • Specific antibodies: Select antibodies specifically validated for IHC applications

  • Appropriate controls: Include Surf1 knockout tissues (when available) as negative controls

  • Co-staining: Perform co-staining with mitochondrial markers (such as TOMM20) to confirm mitochondrial localization

  • Detection method: Fluorescent secondary antibodies often provide better specificity than HRP-based methods

These considerations help ensure specific detection of Surf1 in tissue sections while minimizing background signal and false positives.

How does the knockout mouse model for Surf1 recapitulate human disease phenotypes?

The constitutive Surf1 knockout mouse model demonstrates several key phenotypic features that partially recapitulate human Leigh syndrome caused by SURF1 mutations :

  • High embryonic lethality: Approximately 90% of Surf1 -/- individuals exhibit post-implantation embryonic lethality

  • Reduced lifespan: Surviving mice show early-onset mortality

  • Neuromuscular phenotype: Significant deficits in muscle strength and motor performance

  • Biochemical defects: Profound and isolated defect of COX activity, particularly in skeletal muscle and liver

  • Histopathological findings: Morphological abnormalities of skeletal muscle with reduced COX histochemical reaction and mitochondrial proliferation

Interestingly, unlike human patients, these mice show no obvious abnormalities in brain morphology and minimal neurological symptoms, suggesting species-specific differences in compensatory mechanisms or tissue vulnerability .

What are the most significant differences between mouse and human Surf1 that researchers should consider?

When using mouse models to study Surf1-related disorders, researchers should account for these important differences:

  • Disease severity: Complete Surf1 deficiency causes embryonic lethality in most mice , whereas humans with SURF1 mutations typically survive to birth

  • Tissue specificity: Mouse models show predominant muscle and liver involvement, while humans typically present with severe CNS manifestations

  • Neurological presentation: The mouse model lacks the characteristic neuropathology seen in human Leigh syndrome

  • Protein sequence homology: While mouse and human Surf1 proteins share approximately 80% amino acid identity, there are structural differences that may affect interaction partners

  • Compensatory mechanisms: Evidence suggests different compensatory pathways may exist in mice compared to humans

These differences highlight the importance of cautious interpretation when translating findings from mouse models to human disease mechanisms.

What advanced methodologies can be applied to study Surf1 protein dynamics and interactions in living cells?

Cutting-edge approaches for investigating Surf1 dynamics include:

  • Live-cell imaging: Fluorescently-tagged Surf1 constructs can be used to monitor subcellular localization and dynamics in real-time

  • FRAP (Fluorescence Recovery After Photobleaching): Determines the mobility and exchange rates of Surf1 within the mitochondrial membrane

  • FRET/BRET analysis: Enables detection of protein-protein interactions in living cells by measuring energy transfer between fluorophores

  • Single-molecule tracking: Provides insights into the movement and behavior of individual Surf1 molecules

  • Optogenetic approaches: Light-inducible dimerization systems can be used to manipulate Surf1 interactions temporally

  • Mitochondrial isolation and submitochondrial fractionation: Allows precise localization of Surf1 within mitochondrial compartments

These approaches provide dynamic information about Surf1 behavior that complements traditional biochemical analyses.

How do researchers resolve contradictory findings regarding Surf1's exact role in cytochrome c oxidase assembly?

The precise molecular mechanism of Surf1 in COX assembly remains subject to some contradictions in the literature. To address these contradictions, researchers should:

  • Examine model systems: Differences between yeast, mouse, and human studies may reflect genuine biological differences between species

  • Consider technical approaches: Different methods (in vitro reconstitution vs. cellular studies) may capture different aspects of Surf1 function

  • Temporal dynamics: Surf1 may have different roles at distinct steps of the assembly process, so the timing of experiments is crucial

  • Compensatory mechanisms: In knockout models, adaptive responses may mask primary Surf1 functions

  • Interaction network analysis: Comprehensive analysis of the entire assembly factor network rather than Surf1 in isolation

Systematic investigation with multiple complementary approaches and careful consideration of experimental conditions is essential to reconcile contradictory findings.

What explanations have been proposed for the discrepancy between embryonic lethality in Surf1 knockout mice and viability in human patients?

The striking difference in survival between Surf1-deficient mice and humans has prompted several hypotheses:

  • Residual protein function: Human patients typically have missense mutations that may retain some activity, whereas mouse models often have complete gene deletion

  • Species-specific developmental requirements: Mouse embryonic development may have stricter requirements for mitochondrial function

  • Genetic background effects: The genetic background of mouse models influences phenotype severity

  • Compensatory pathways: Humans may possess more robust compensatory mechanisms for COX assembly

  • Tissue-specific vulnerability differences: Critical developmental thresholds may differ between species

Research approaches to address this question include generating "humanized" mouse models expressing human SURF1 mutations and detailed comparative analyses of COX assembly pathways between species .

How should researchers interpret minor variations in experimental results when using different recombinant Surf1 preparations?

When confronting variability between different Surf1 preparations, consider:

  • Expression system differences: Proteins produced in E. coli versus mammalian systems may have different post-translational modifications

  • Tag interference: Different fusion tags can affect protein folding, interactions, or function

  • Preparation methods: Detergent selection and purification protocols can alter protein conformation

  • Storage conditions: Freeze-thaw cycles and storage buffers impact protein stability

  • Batch-to-batch variation: Even identical protocols can yield variations in activity

Best practices include:

  • Using consistent sources for critical experiments

  • Including positive controls with established activity

  • Validating each new preparation against functional benchmarks

  • Reporting detailed methodology including expression system, purification method, and storage conditions

What strategies can address poor solubility or aggregation of Recombinant Mouse Surf1 during purification?

As a membrane protein, Surf1 presents inherent challenges for solubility. Effective strategies include:

  • Detergent optimization: Screen multiple detergents (DDM, LMNG, digitonin) at various concentrations to identify optimal solubilization conditions

  • Fusion partners: Addition of solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO

  • Buffer optimization: Test different pH values, salt concentrations, and additives (glycerol, arginine) to enhance stability

  • Temperature control: Perform all purification steps at 4°C and avoid freeze-thaw cycles

  • Co-expression with chaperones: Express Surf1 together with molecular chaperones to improve folding

  • Amphipols or nanodiscs: Transfer purified protein from detergent to more stable membrane mimetics for downstream applications

Systematic optimization of these parameters can significantly improve yield and quality of purified Recombinant Mouse Surf1.

What are common pitfalls in designing experiments to measure cytochrome c oxidase assembly with Recombinant Surf1?

When investigating COX assembly with recombinant Surf1, researchers should be aware of these potential pitfalls:

  • Subcellular targeting: Recombinant Surf1 must be properly targeted to mitochondria to function, requiring consideration of mitochondrial targeting sequences and import machinery

  • Complex stability: The COX complex is notoriously fragile during purification; gentle solubilization conditions are essential

  • Assembly intermediates: Failing to capture transient assembly intermediates can lead to misinterpretation of Surf1's role

  • Cofactor availability: Ensure adequate supply of heme and copper cofactors needed for proper assembly

  • Heterologous systems: Compatibility issues between mouse Surf1 and human or yeast COX subunits in mixed systems

  • Assay timing: Assembly occurs over an extended time period; single timepoint analyses may miss critical steps

Using pulse-chase approaches, capturing assembly intermediates with native gel electrophoresis, and employing complementary functional and structural assays can overcome these challenges.

How can researchers validate antibody specificity for Surf1 to ensure reliable immunodetection results?

Rigorous validation of Surf1 antibodies should include:

  • Western blot analysis: Compare bands between wild-type and Surf1 knockout samples; specific antibodies should show absence of signal in knockout samples

  • Peptide competition: Pre-incubation of antibody with the immunizing peptide should eliminate specific signal

  • Multiple antibodies: Use antibodies raised against different Surf1 epitopes to confirm consistent detection

  • Recombinant protein controls: Include purified Recombinant Mouse Surf1 as a positive control

  • Immunoprecipitation-mass spectrometry: Confirm that immunoprecipitated protein is indeed Surf1 by mass spectrometry

  • Subcellular localization: Verify mitochondrial localization consistent with known Surf1 distribution

These validation steps are essential for avoiding artifacts and misinterpretation of experimental results, particularly in studies of protein expression, localization, or interaction.

What novel experimental approaches are emerging for studying Surf1 function and interactions?

Cutting-edge approaches that promise to advance Surf1 research include:

  • Cryo-electron microscopy: Providing structural insights into Surf1's interactions with the COX assembly complex

  • Proximity-dependent biotin labeling (BioID, APEX): Identifying transient interaction partners in the native cellular environment

  • Single-cell proteomics: Revealing cell-to-cell variability in Surf1 expression and function

  • CRISPR-based screening: Identifying genetic modifiers of Surf1 function through genome-wide screens

  • Patient-derived iPSC models: Creating disease-relevant human cellular models of Surf1 deficiency

  • In situ structural biology: Techniques like correlative light and electron microscopy (CLEM) to visualize Surf1 in its native context

These emerging technologies promise to overcome current limitations in understanding Surf1's precise molecular mechanism of action.

How might research on mouse Surf1 contribute to therapeutic development for human mitochondrial disorders?

Mouse Surf1 research can accelerate therapeutic development through:

  • Drug screening platforms: Using Surf1-deficient mouse cells to screen for compounds that bypass or compensate for Surf1 deficiency

  • Gene therapy testing: Evaluating viral vector-based gene replacement strategies in the knockout mouse model

  • Mechanistic insights: Identifying downstream consequences of Surf1 deficiency that might represent more tractable therapeutic targets

  • Biomarker discovery: Establishing reliable markers of disease progression and treatment response

  • Preclinical testing: Evaluating safety and efficacy of candidate therapies before human trials

  • Allosteric modulators: Developing compounds that may enhance the function of mutant Surf1 in patients with missense mutations

The Surf1 knockout mouse model provides a valuable platform for testing therapeutic hypotheses, despite some differences from the human condition .

What are the implications of recent findings regarding Surf1's potential roles beyond cytochrome c oxidase assembly?

Emerging evidence suggests Surf1 may have functions beyond its classical role in COX assembly:

  • Mitochondrial stress response: Possible involvement in coordinating cellular responses to mitochondrial dysfunction

  • Metabolic adaptation: Potential role in metabolic reprogramming under stress conditions

  • Redox regulation: Proposed functions in maintaining mitochondrial redox balance

  • Alternative respiratory pathways: Possible interactions with components of non-canonical respiratory complexes

  • Mitochondrial dynamics: Potential influence on mitochondrial fusion/fission events and morphology

These emerging functions suggest Surf1 may be integrated into broader mitochondrial quality control networks, with implications for understanding both normal physiology and disease mechanisms in Surf1 deficiency.

What are the relative advantages of different experimental models for studying Surf1 function?

Researchers should consider these comparative advantages when selecting models:

Model SystemKey AdvantagesLimitationsBest Applications
Knockout miceIn vivo physiology, tissue interactionsHigh embryonic lethality, species differencesSystemic effects, tissue specificity
Cell lines (immortalized)Ease of manipulation, cost-effectiveMay not reflect physiological contextMechanistic studies, high-throughput screening
Patient-derived fibroblastsDisease-relevant mutationsLimited cell types availableTranslational studies, personalized medicine
Induced pluripotent stem cellsMultiple cell types, human geneticsTechnical complexity, variabilityDisease modeling, developmental aspects
Yeast modelsRapid genetic manipulationEvolutionary distance from mammalsBasic assembly mechanism studies
In vitro reconstitutionPrecise biochemical controlLacks cellular contextDirect biochemical mechanism studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.