Recombinant Mouse Surfeit locus protein 4 (Surf4)

Shipped with Ice Packs
In Stock

Description

Biological Functions

Surf4 regulates secretory pathways by acting as a cargo receptor for soluble proteins:

Lipoprotein Trafficking

  • Liver-specific Surf4 knockout reduces plasma lipids and prevents atherosclerosis in mice .

  • Intestinal Surf4 deficiency impairs chylomicron secretion, leading to lipid malabsorption and weight loss .

Prohormone Transport

  • Surf4 binds proinsulin via its N-terminal tripeptide motif, facilitating ER export and insulin secretion in pancreatic β-cells .

  • Loss of Surf4 causes proinsulin retention in the ER and reduces insulin granule formation .

Embryonic Development

  • Germline Surf4 deletion in mice results in embryonic lethality, highlighting its necessity in early development .

  • Heterozygous Surf4+/- mice exhibit normal growth but show altered lipid metabolism .

Research Findings from Murine Studies

Study FocusMethodologyKey FindingsReferences
Embryonic ViabilityCRISPR/Cas9-mediated Surf4 knockoutHomozygous Surf4-/- embryos fail to develop beyond E6.5 due to metabolic defects
Lipid MetabolismLiver/intestine-specific Surf4 deletionReduced plasma lipids, improved atherosclerosis resistance
Insulin SecretionsiRNA knockdown in INS-1 β-cells50–70% reduction in glucose-stimulated insulin secretion
Cargo RecognitionER-ESCAPE motif binding assaysSurf4 binds N-terminal tripeptides (e.g., DSPP, AMELX) to prevent ER aggregation

Therapeutic Implications

  • Atherosclerosis: Targeting hepatic Surf4 could reduce circulating LDL and VLDL .

  • Diabetes: Enhancing Surf4 activity might improve insulin secretion in β-cell dysfunction .

  • Neurodegeneration: Surf4-mediated progranulin trafficking may mitigate frontotemporal dementia .

Limitations and Future Directions

  • Compensatory Mechanisms: Redundancy with other cargo receptors (e.g., ERGIC-53) remains unexplored .

  • Structural Data: High-resolution Surf4-cargo complex structures are needed to refine therapeutic targeting.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us beforehand, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please provide us with the details, and we will prioritize developing the specified tag.
Synonyms
Surf4; Surf-4; Surfeit locus protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Surf4
Target Protein Sequence
MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWS CGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFF SIIQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW
Uniprot No.

Target Background

Function
Surfeit locus protein 4 (Surf4) is an endoplasmic reticulum cargo receptor that facilitates the export of lipoproteins by recruiting cargos into COPII vesicles for secretion. It serves as a cargo receptor for lipoproteins containing both APOB and APOA1, playing a crucial role in regulating lipoprotein delivery and maintaining lipid homeostasis. Surf4 synergizes with the GTPase SAR1B to mediate the transport of circulating lipoproteins. Additionally, it promotes the secretion of PCSK9 and facilitates the efficient secretion of erythropoietin (EPO). Surf4 may also contribute to maintaining the structural integrity of the endoplasmic reticulum-Golgi intermediate compartment and the Golgi apparatus.
Gene References Into Functions
  1. NIH3T3 cells overexpressing SURF4 induced tumor growth in mice. PMID: 29777698
Database Links
Protein Families
SURF4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Surf4 and where is it expressed in mice?

Surf4 (Surfeit locus protein 4) is an endoplasmic reticulum (ER) cargo receptor protein that plays essential roles in protein secretion and lipid metabolism. The Mus musculus Surf4 gene is located on chromosome 2 within the tightly clustered surfeit gene locus, comprising 6 exons and 5 introns spanning approximately 14 kb . Surf4 is widely expressed across multiple mouse tissues including intestine, liver, heart, spleen, lung, kidney, adrenal gland, and reproductive organs . Expression levels may vary between tissues, with particularly important functions observed in metabolically active tissues like intestine and liver.

Within cells, Surf4 primarily localizes to the ER and ER-Golgi intermediate compartment, consistent with its role in facilitating cargo transport between these compartments . Subcellular localization studies show that Surf4 colocalizes with apoB in enterocytes and co-immunoprecipitates with apoB48 in differentiated Caco-2 cells, supporting its role in chylomicron assembly and secretion .

What are the main physiological functions of Surf4 in mice?

Surf4 serves multiple critical physiological functions in mice:

  • Embryonic development: Germline deletion of Surf4 is lethal during early embryonic development, demonstrating its essential role in developmental processes .

  • Lipid metabolism and transport: Surf4 mediates very low-density lipoprotein (VLDL) secretion from hepatocytes and is crucial for chylomicron secretion from enterocytes . It plays an essential role in intestinal lipid absorption and subsequent delivery to circulation.

  • Protein cargo receptor function: Surf4 promotes loading of luminal cargos into COPII-coated vesicles, facilitating their exit from the ER . It interacts with specific proteins including prosaposin and progranulin to regulate their transport to lysosomes .

  • Cholesterol homeostasis regulation: Surf4 has been identified as a cargo receptor for Proprotein convertase subtilisin/kexin type 9 (PCSK9), influencing PCSK9 secretion and consequently affecting LDLR levels and cholesterol metabolism .

These functions position Surf4 as a key regulator at the intersection of lipid metabolism, protein trafficking, and cardiovascular health.

What mouse models are available for studying Surf4 function?

Several mouse models have been developed to study Surf4 function:

Table 1: Mouse Models for Studying Surf4

Model TypeDescriptionKey FeaturesResearch ApplicationsReference
Inducible intestinal-specific Surf4 knockdown (Surf4 IKO)Generated using Vil1Cre-ER T2 and Surf4 flox miceSelective reduction of Surf4 in intestine; sex differences in phenotypesIntestinal lipid absorption; metabolism; chylomicron secretion
Heterozygous intestinal Surf4 knockdown (Surf4 HTZ)Similar to IKO but with partial reductionMilder phenotype than homozygous knockdownDose-dependent effects of Surf4 reduction
CRISPR/Cas9-generated germline Surf4 mutantsMultiple alleles with frameshift or in-frame deletionsEarly embryonic lethality for null allelesDevelopmental roles; allelic series for structure-function

The inducible intestinal-specific knockdown model (Surf4 IKO) has proven particularly valuable for studying Surf4 function in lipid metabolism without the confounding effect of embryonic lethality . This model shows that male Surf4 IKO mice display more severe phenotypes than females, including greater body weight loss, more pronounced metabolic alterations, and higher mortality . The difference appears related to higher residual Surf4 expression in female intestines, although this difference doesn't reach statistical significance (mean expression of Surf4 protein=0.133 in male and 0.233 in female Surf4 IKO; P=0.092) .

What experimental techniques are most effective for characterizing Surf4 deficiency phenotypes?

Several complementary techniques are essential for comprehensive characterization of Surf4 deficiency:

  • Metabolic phenotyping: Metabolic cages provide crucial data on food/water intake, heat production, activity levels, oxygen consumption (VO₂), carbon dioxide production (VCO₂), and respiratory quotient (RQ) . These parameters reveal that Surf4 IKO mice exhibit reduced metabolism with decreased food/water intake, heat production, activity, and VO₂, alongside increased RQ (indicating less fat utilization) .

  • Lipid metabolism assessment: A combination of techniques is recommended:

    • Enzymatic kits for measuring serum and tissue lipid levels (triglycerides, cholesterol, free fatty acids)

    • Radiolabeled oleic acid assays to track intestinal lipid absorption and secretion

    • Transmission electron microscopy to visualize enterocyte structure and lipid accumulation

  • Molecular interaction studies: Co-immunoprecipitation and colocalization assays effectively demonstrate Surf4's interaction with partner proteins like apoB48, essential for understanding its mechanism in chylomicron assembly .

  • Proteomics: Mass spectrometry-based proteomics provides comprehensive insight into protein expression changes in both serum and tissues (e.g., jejunum) following Surf4 depletion, revealing broader pathway alterations beyond the direct targets .

  • Gene expression analysis: qRT-PCR and Western blot analysis effectively confirm tissue-specific knockdown and assess expression changes in related pathway components .

How does Surf4 deficiency impact chylomicron formation and secretion at the molecular level?

Surf4 deficiency profoundly disrupts chylomicron formation and secretion through multiple mechanisms:

  • Disrupted protein-protein interactions: Surf4 directly interacts with apolipoprotein B (apoB), as demonstrated by colocalization and co-immunoprecipitation studies with apoB48 in differentiated Caco-2 cells . This interaction appears crucial for proper chylomicron assembly.

  • Impaired ER cargo loading: As a cargo receptor that promotes loading of luminal cargo into COPII vesicles, Surf4 deficiency leads to accumulation of small lipid vacuoles within the ER lumen of enterocytes . This suggests Surf4 is essential for incorporating lipidated apoB into COPII vesicles for ER export.

  • Cytosolic lipid droplet accumulation: Transmission electron microscopy reveals significant accumulation of lipid droplets in the cytosol of enterocytes from Surf4 IKO mice . This indicates defective packaging of absorbed dietary lipids into chylomicrons.

  • Reduced serum lipid levels: Intestinal Surf4 deficiency leads to significantly reduced serum triglyceride, cholesterol, and free fatty acid levels in mice . This reflects the compromised ability to deliver dietary lipids to circulation.

The molecular mechanism likely involves Surf4's role in coordinating the incorporation of lipidated apoB48 into COPII vesicles at ER exit sites, a critical step in chylomicron maturation and secretion. Disruption of this process causes backup of lipids within enterocytes and reduced lipid delivery to circulation.

What are the sex-dependent differences in Surf4 function and how might they be explained?

Significant sex-dependent differences have been observed in Surf4 function, particularly in the context of intestinal Surf4 deficiency:

  • Phenotypic severity: Male Surf4 IKO mice exhibit more severe phenotypes than females, including:

    • Greater body weight loss

    • Higher mortality rates

    • More pronounced metabolic alterations (reduced food/water intake, heat production, activity)

  • Residual Surf4 expression: Female Surf4 IKO mice tend to maintain higher residual levels of Surf4 in intestinal tissue:

    • Higher residual mRNA levels of Surf4 compared to males

    • Slightly higher Surf4 protein expression in females (mean=0.233) compared to males (mean=0.133), though this difference doesn't reach statistical significance (P=0.092)

  • Metabolic differences: Sex-specific metabolic adaptations are evident:

    • Males show significant reductions in multiple metabolic parameters (food/water intake, heat production, activity, oxygen consumption)

    • Females show similar trends but with fewer parameters reaching statistical significance

Several factors may explain these sex-dependent differences:

  • Hormonal influences: Sex hormones may modulate Surf4 expression or the physiological response to its deficiency

  • Compensatory mechanisms: Females may possess more robust compensatory pathways for maintaining lipid homeostasis

  • Differential Cre recombinase efficiency: The Vil1Cre-ER system may exhibit sex-dependent recombination efficiency

  • Baseline metabolic differences: Inherent sex differences in lipid metabolism may interact with Surf4 deficiency

These findings highlight the importance of including both sexes in Surf4 research and suggest potential sex-specific therapeutic considerations for any Surf4-targeting interventions.

What are the recommended methods for generating and validating Surf4 knockdown or knockout models?

Based on successful approaches in the literature, the following methods are recommended:

  • For conditional tissue-specific Surf4 knockdown:

    • The Vil1Cre-ER T2 system combined with Surf4 flox mice has proven effective for intestine-specific inducible knockdown

    • Validation should include:

      • Western blot analysis of target tissue protein levels

      • qRT-PCR confirmation of reduced mRNA expression

      • Assessment of off-target effects by measuring Surf4 levels in non-targeted tissues

  • For global Surf4 knockout using CRISPR/Cas9:

    • Target exon 2 of Surf4 as previously validated

    • Verify sgRNA efficiency in embryonic stem cells before zygote injection

    • Generate multiple founders to obtain various alleles (frameshift and in-frame)

    • Confirm germline transmission through breeding to wild-type mice

    • Perform Sanger sequencing to characterize exact mutations

  • For cellular Surf4 knockout models:

    • CRISPR/Cas9 genome editing of cultured cells has been successful

    • Validate knockout by:

      • Western blot analysis

      • Functional assays such as Endo H sensitivity to detect ER accumulation of cargo proteins

      • Immunofluorescence to assess subcellular localization changes of Surf4 client proteins

Table 2: Validation Methods for Surf4 Models

Validation MethodApplicationKey MeasurementsExpected Results
Western blotProtein expressionSurf4 protein levels>70% reduction in knockdown models; complete absence in knockout
qRT-PCRmRNA expressionSurf4 transcript levelsSignificantly reduced in target tissues; unchanged in non-targeted tissues
ImmunofluorescenceSubcellular localizationDistribution of Surf4 and client proteinsAltered localization of client proteins (ER retention)
Functional assaysPhysiological impactLipid absorption, chylomicron secretionImpaired lipid transport, accumulation in enterocytes
Phenotypic assessmentWhole-organism effectsBody weight, mortality, metabolismReduced weight, altered metabolism, potential mortality

What experimental design is optimal for studying the interaction between Surf4 and apoB in chylomicron assembly?

To rigorously investigate Surf4-apoB interactions in chylomicron assembly, a multi-level experimental approach is recommended:

  • Cellular models:

    • Differentiated Caco-2 cells provide an established intestinal epithelial model

    • Primary enterocytes isolated from wild-type and Surf4 IKO mice offer physiologically relevant comparison

    • Design should include lipid challenge conditions (e.g., oleic acid treatment) to stimulate chylomicron formation

  • Interaction analysis:

    • Co-immunoprecipitation assays with antibodies against Surf4 to pull down associated apoB48

    • Reciprocal co-immunoprecipitation with anti-apoB antibodies

    • Proximity ligation assays to visualize and quantify interactions in situ

    • For detailed binding characterization, consider surface plasmon resonance or microscale thermophoresis with purified components

  • Subcellular localization:

    • Confocal microscopy with dual immunofluorescence labeling of Surf4 and apoB

    • Super-resolution microscopy for more detailed colocalization analysis

    • Live-cell imaging with fluorescently tagged proteins to track dynamic interactions

  • Functional assessment:

    • Measure chylomicron secretion following siRNA-mediated knockdown of Surf4

    • Compare wild-type Surf4 with mutant versions lacking specific domains to identify interaction regions

    • Assess lipid incorporation into apoB-containing particles using radiolabeled lipids

  • Structural studies:

    • Domain mapping to identify specific regions of Surf4 required for apoB interaction

    • In silico molecular docking to predict interaction interfaces

    • Cryo-electron microscopy of purified complexes for structural characterization

Control experiments should include:

  • Non-specific IgG controls for immunoprecipitation

  • Expression of irrelevant proteins with similar topology to Surf4

  • Comparison with other known COPII cargo receptors to establish specificity

This comprehensive approach can elucidate not only the physical interaction between Surf4 and apoB but also its functional significance in chylomicron assembly and secretion.

How should researchers interpret contradictory findings between in vitro and in vivo Surf4 studies?

When facing contradictions between in vitro and in vivo Surf4 studies, consider the following interpretive framework:

  • Contextual differences:

    • In vivo systems contain complex compensatory mechanisms absent in vitro

    • Cell-type specific effects may not translate between simplified cell models and whole organisms

    • Example: While Surf4 knockout in cells causes accumulation of client proteins in the ER , intestinal Surf4 deficiency in mice leads to both ER accumulation and cytosolic lipid droplet formation

  • Protein concentration effects:

    • In vitro overexpression systems often use non-physiological protein levels

    • Concentration dependencies may create artificial interactions or mask genuine ones

    • Validate key findings using endogenous protein levels whenever possible

  • Temporal considerations:

    • Acute effects observed in vitro may differ from chronic adaptations in vivo

    • Inducible knockout models allow examination of both immediate and long-term consequences of Surf4 deficiency

  • Sex differences:

    • In vitro studies typically don't account for sex differences observed in vivo

    • Significant differences between male and female Surf4 IKO mice highlight the importance of considering sex as a biological variable

    • Cell lines are often derived from a single sex and may not represent both sexes equally

  • Methodological approaches for resolution:

    • Use primary cells from Surf4 mouse models to bridge in vitro/in vivo disparities

    • Employ tissue-specific conditional knockouts to isolate cell-autonomous effects

    • Validate in vitro findings through targeted in vivo experiments

    • Consider developmental timing using inducible systems

When interpreting contradictory findings, the more complex in vivo context generally provides greater physiological relevance, but in vitro systems offer better control and mechanistic clarity. The ideal approach incorporates both perspectives, using in vitro findings to generate hypotheses that can be tested and refined in vivo.

What are common technical challenges in studying Surf4 function and how can they be addressed?

Researchers face several technical challenges when studying Surf4:

  • Embryonic lethality of global knockout:

    • Challenge: Complete Surf4 deficiency causes early embryonic lethality

    • Solutions:

      • Use conditional tissue-specific knockdown/knockout models

      • Employ inducible systems (e.g., tamoxifen-inducible Cre) for temporal control

      • Generate hypomorphic alleles through careful CRISPR design

  • Variability in knockdown efficiency:

    • Challenge: Variable Surf4 knockdown between animals and sexes complicates interpretation

    • Solutions:

      • Include larger sample sizes to account for variability

      • Quantify Surf4 levels in each experimental animal and correlate with phenotypes

      • Consider stratifying analysis based on knockdown efficiency

  • Sex-dependent effects:

    • Challenge: Male and female mice show different responses to Surf4 deficiency

    • Solutions:

      • Always include both sexes in experimental design

      • Analyze data separately by sex before pooling

      • Ensure sufficient power to detect sex-specific effects

  • Distinguishing direct from indirect effects:

    • Challenge: As a cargo receptor, Surf4 affects multiple client proteins, making it difficult to attribute phenotypes to specific interactions

    • Solutions:

      • Perform rescue experiments with selective client proteins

      • Use systems biology approaches like proteomics to identify affected pathways

      • Develop client-specific interaction inhibitors

  • Technical difficulties in chylomicron analysis:

    • Challenge: Chylomicrons are complex, heterogeneous particles that are challenging to isolate and characterize

    • Solutions:

      • Use density gradient ultracentrifugation for purification

      • Employ dynamic light scattering to assess particle size distribution

      • Combine with apoB immunodetection for specificity

Table 3: Troubleshooting Common Technical Issues in Surf4 Research

Technical ChallengeManifestationPotential SolutionsValidation Approach
Poor antibody specificityMultiple bands in Western blotUse epitope-tagged Surf4; validate with knockout controlsCompare signal between wild-type and knockout samples
Inconsistent knockdownVariable phenotypesOptimize tamoxifen dosing; extend induction periodQuantify knockdown by Western blot in each animal
High mortality in male miceExperimental attritionStart with larger cohorts; consider earlier endpointsMonitor body weight daily as predictor of mortality
Lipid extraction variabilityInconsistent lipid measurementsStandardize fasting conditions; normalize to tissue weightInclude internal standards in extraction protocol
Confounding by hepatic effectsSecondary phenotypesConfirm intestine-specific knockdown; measure hepatic Surf4Use liver-specific markers to detect hepatic dysfunction

By anticipating these challenges and implementing appropriate methodological refinements, researchers can generate more consistent and interpretable data on Surf4 function.

What are the potential therapeutic implications of targeting Surf4 for cardiovascular disease?

The role of Surf4 in lipid metabolism suggests potential therapeutic applications for cardiovascular disease:

  • Atherosclerosis reduction:

    • Previous studies show that silencing hepatic Surf4 markedly reduces atherosclerosis development in mouse models without causing hepatic steatosis

    • The mechanism involves reduced very low-density lipoprotein secretion from hepatocytes

  • Postprandial dyslipidemia management:

    • Intestinal Surf4 deficiency reduces serum triglyceride, cholesterol, and free fatty acid levels

    • This suggests potential utility in reducing postprandial dyslipidemia, a causative risk factor for cardiovascular disease

  • Targeting considerations:

    • Tissue-specific targeting is crucial, as global Surf4 inhibition would likely have detrimental effects given its embryonic lethality

    • The authors explicitly state that "therapeutic use of Surf4 inhibition requires highly cell/tissue-specific targeting"

  • Sex-specific responses:

    • Therapeutic strategies may need sex-specific dosing or approaches given the observed differences between male and female mice

    • Males show stronger responses to Surf4 inhibition but also more adverse effects

  • Potential approaches:

    • Hepatocyte-specific small molecule inhibitors of Surf4-cargo interactions

    • Antisense oligonucleotides with liver-targeted delivery systems

    • Structure-based design of selective Surf4 modulators that affect specific cargo interactions

The optimal therapeutic approach would balance atheroprotective effects of reduced lipoprotein secretion against potential negative impacts on other Surf4 functions. Current evidence suggests liver-specific targeting may offer the best therapeutic window, while intestinal targeting requires careful consideration of potential malabsorption and metabolic consequences.

What are the most promising future research directions for understanding Surf4 biology?

Several high-priority research directions would significantly advance our understanding of Surf4 biology:

  • Comprehensive cargo identification:

    • Systematic proteomic analysis to identify the complete repertoire of Surf4 client proteins

    • Investigation of cargo recognition motifs and binding determinants

    • Understanding how Surf4 distinguishes between different cargo proteins

  • Structural biology approaches:

    • Determination of Surf4 structure alone and in complex with cargo proteins

    • Structural basis for COPII interaction and cargo loading

    • Conformational changes during the transport cycle

  • Tissue-specific functions:

    • Exploration of Surf4 roles beyond the intestine and liver

    • Investigation of potential functions in the nervous system

    • Understanding the basis of embryonic lethality in Surf4 knockout mice

  • Regulatory mechanisms:

    • Identification of factors that regulate Surf4 expression and activity

    • Investigation of post-translational modifications affecting Surf4 function

    • Understanding how Surf4 activity responds to metabolic challenges

  • Human disease relevance:

    • Analysis of SURF4 variants in human populations

    • Association studies with lipid disorders and cardiovascular disease

    • Potential roles in other conditions involving protein trafficking defects

  • Therapeutic development:

    • Design of selective inhibitors of specific Surf4-cargo interactions

    • Development of tissue-targeted delivery approaches

    • Exploration of compensatory mechanisms that might limit therapeutic efficacy

These research directions would not only advance our fundamental understanding of cellular protein trafficking but could also lead to novel therapeutic approaches for cardiovascular disease and potentially other conditions related to protein secretion and lipid metabolism.

What are the recommended protocols for analyzing the impact of Surf4 on lipid metabolism in mice?

Based on successful approaches in the literature, the following protocols are recommended for comprehensive analysis of Surf4's impact on lipid metabolism:

  • Metabolic assessment protocol:

    • House mice individually in metabolic cages for 48-72 hours

    • Allow 24 hours for acclimation before beginning measurements

    • Record food/water intake, heat production, activity, VO₂, VCO₂, and calculate RQ

    • Analyze data by dividing into light cycle, dark cycle, and 24-hour measurements

    • Use non-parametric statistical tests (Mann-Whitney U test for two groups, Kruskal-Wallis with Dunn test for multiple groups)

  • Intestinal lipid absorption and secretion analysis:

    • Fast mice for 4 hours in the morning

    • Administer radiolabeled oleic acid by oral gavage

    • Collect blood samples at defined intervals (0, 1, 2, 4 hours)

    • Sacrifice mice and collect tissues (intestine, liver) at terminal timepoint

    • Measure radioactivity in plasma and tissues to track lipid movement

  • Transmission electron microscopy of enterocytes:

    • Collect 2-3 mm segments of proximal jejunum

    • Fix immediately in glutaraldehyde/paraformaldehyde

    • Process for standard TEM with osmium tetroxide post-fixation

    • Examine for:

      • Lipid droplet accumulation in cytosol

      • Lipid vacuoles in ER lumen

      • Abnormalities in ER and Golgi structure

  • Lipoprotein profile analysis:

    • Collect blood from fasted mice (4-hour fast)

    • Separate lipoprotein fractions by fast protein liquid chromatography

    • Measure triglyceride and cholesterol content in each fraction

    • Analyze chylomicron production by comparing postprandial samples at different timepoints

  • Proteomics analysis:

    • Collect serum and jejunum samples

    • Process for mass spectrometry-based proteomics

    • Analyze for changes in protein expression

    • Conduct pathway analysis to identify altered biological processes

What controls and validation steps are essential when working with recombinant mouse Surf4 protein?

When working with recombinant mouse Surf4 protein, the following controls and validation steps are essential:

  • Protein quality assessment:

    • SDS-PAGE with Coomassie staining to verify purity and molecular weight

    • Western blot with Surf4-specific antibodies to confirm identity

    • Mass spectrometry to verify primary sequence and post-translational modifications

    • Size exclusion chromatography to assess aggregation state

  • Functional validation:

    • Binding assays with known cargo proteins (e.g., apoB, PCSK9)

    • COPII vesicle budding assays to confirm cargo loading function

    • Liposome binding assays to assess membrane association

    • Circular dichroism to verify proper folding

  • Essential controls for experiments:

    • Heat-inactivated Surf4 protein as negative control

    • Relevant non-cargo proteins to establish binding specificity

    • Concentration-matched carrier protein (if using carrier-free preparation)

    • Wild-type protein for comparison with mutant variants

  • Cell-based validation:

    • Rescue experiments in Surf4-deficient cells

    • Localization studies to confirm proper targeting to ER/ERGIC

    • Cargo secretion assays to verify functional activity

    • Dominant-negative effects of mutant versions

  • Storage and handling considerations:

    • Avoid repeated freeze-thaw cycles

    • Store lyophilized protein at -20°C

    • Reconstitute in appropriate buffer immediately before use

    • Test stability under experimental conditions

  • Experimental design considerations:

    • Dose-response experiments to determine optimal concentration

    • Time-course studies to capture dynamic interactions

    • Include positive control proteins with known activity

    • Validate key findings with complementary approaches

By incorporating these controls and validation steps, researchers can ensure that experimental outcomes accurately reflect the biological functions of Surf4 rather than artifacts related to protein quality or experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.