Recombinant Mouse Synaptogyrin-2 (Syngr2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Pathogen Interactions

Syngr2 facilitates viral and bacterial infections through vesicle-mediated mechanisms:

  • Viral replication:

    • Binds SFTSV NSs protein to restructure lipid droplets into viral factories, enhancing RNA replication .

    • CRISPR/Cas9 knockdown reduces SFTSV titers by >90% and disrupts inclusion body formation .

    • Overexpression increases SFTSV M gene transcripts by 3–5 fold .

  • Bacterial toxin uptake:

    • Mediates internalization of Aggregatibacter actinomycetemcomitans CdtB toxin .

  • SARS-CoV-2 entry:

    • Interacts with spike protein via N-terminal and intraluminal domains (K<sub>D</sub> ~10<sup>-3</sup>–10<sup>-4</sup> M) .

    • Calu-3 cells with reduced Syngr2 expression show 70% resistance to pseudotyped SARS-CoV-2 .

Recombinant Syngr2 in Experimental Models

While explicit studies on recombinant mouse Syngr2 are sparse, inferred applications include:

  • Protein interaction assays:

    • Co-immunoprecipitation studies (e.g., SFTSV NSs binding in HepG2 cells) .

    • Surface plasmon resonance (SPR) to map spike protein binding sites .

  • CRISPR/Cas9 complementation:

    • Rescue experiments in Syngr2-knockout cells to validate viral replication mechanisms .

Table 2: Key experimental findings using Syngr2 modulation

PathogenSyngr2 ManipulationOutcomeReference
SFTSVOverexpression275-fold ↑ Syngr2 mRNA, 3× ↑ viral titer
PCV2Arg63Cys substitution40–60% ↓ viral replication
SARS-CoV-2siRNA knockdown70% ↓ pseudovirus entry

Evolutionary and Translational Insights

  • Adaptive evolution:

    • The porcine Arg63Cys variant arose post-domestication in European swine and reduces PCV2 replication .

    • Positive selection signatures in Syngr2’s intraluminal loops across mammals suggest host-pathogen coevolution .

  • Therapeutic potential:

    • Targeting Syngr2-pathogen interactions could offer broad-spectrum antiviral strategies .

Research Gaps and Future Directions

  • Structural resolution of mouse Syngr2 complexes with viral proteins.

  • High-throughput screens for Syngr2 inhibitors using recombinant protein libraries.

  • In vivo validation of Syngr2’s role in murine models of viral infection.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your reconstitution.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
Syngr2; Synaptogyrin-2; Cellugyrin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Syngr2
Target Protein Sequence
MESGAYGAANAGGSFDLRRFLSQPQVVTRLVSMVLALIVFSCIFGEGYTNIHTSDQLYCV FNQNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWF VGFCFLTNQWAATKPQDVRVGADSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQN YVDPTPDPNTAYASYPSASVENYQQPPFTQNVETTEGYQPPPVY
Uniprot No.

Target Background

Function
Synaptogyrin-2 (Syngr2) may play a role in regulated exocytosis. In neuronal cells, it modulates the localization of synaptophysin/SYP into synaptic-like microvesicles, potentially influencing the formation and/or maturation of these vesicles. Syngr2 may also be involved in GLUT4 storage and transport to the plasma membrane.
Database Links

KEGG: mmu:20973

UniGene: Mm.468228

Protein Families
Synaptogyrin family
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein.

Q&A

What is Synaptogyrin-2 and how does it differ from other synaptogyrin family members?

Synaptogyrin-2 is a non-neural member of the synaptogyrin family of proteins. While other members like Synaptogyrin-3 are primarily involved in neuronal functions, Synaptogyrin-2's role extends beyond neural tissues. The synaptogyrin family is generally important in the biogenesis and trafficking of synaptic vesicles, but Synaptogyrin-2's specific function has been less characterized compared to its neural counterparts .

Methodologically, differentiating between synaptogyrin family members requires careful design of PCR primers or antibodies targeting unique regions. For immunohistochemical characterization, researchers should use specific antibodies that do not cross-react with other synaptogyrin family members, particularly when analyzing tissues that might express multiple isoforms.

What are the established protocols for expressing recombinant mouse Synaptogyrin-2?

For successful expression of recombinant mouse Synaptogyrin-2, researchers typically employ the following methodology:

  • Clone the full-length mouse Syngr2 cDNA into an appropriate expression vector (e.g., pCMV, pET, or pAAV)

  • Transform the construct into competent bacteria for amplification

  • For mammalian expression, transfect the purified plasmid into target cells using either lipid-based transfection reagents, electroporation, or viral vectors

  • For viral vector-based expression (particularly useful for in vivo studies), package the Syngr2 gene into AAV or lentiviral vectors

Confirmation of successful expression should be performed using both RT-PCR and Western blot analysis to verify mRNA and protein expression levels, respectively. For visualization purposes, tagging Syngr2 with fluorescent proteins like mCherry has proven effective in tracking its cellular localization .

What cell lines are most appropriate for studying mouse Synaptogyrin-2 function?

Based on research findings, several cell lines have been successfully used to study Synaptogyrin-2:

Cell LineApplicationAdvantagesLimitations
HepG2Viral interaction studiesHigh expression of Syngr2 upon inductionHuman cell line; potential species differences
HeLaKnockdown/overexpression studiesEasily transfectable; stable expressionNon-physiological for neural studies
HEK293Protein expression and interaction studiesHigh transfection efficiencyLimited physiological relevance for some applications

For physiologically relevant studies, primary mouse hepatocytes or neuronal cultures may be more appropriate depending on the research question. When establishing a stable cell line with altered Syngr2 expression, lentiviral delivery of shRNA (for knockdown) or the gene (for overexpression) has demonstrated high efficiency and sustained expression changes .

How does Synaptogyrin-2 contribute to viral replication mechanisms, and what methodologies should be used to study this function?

Synaptogyrin-2 plays a critical role in viral replication, particularly for the SFTS bunyavirus (SFTSV). Research has revealed that Syngr2 interacts with the viral non-structural protein (NSs) and is translocated into inclusion bodies (IBs), which are reconstructed from lipid droplets into large virus factories .

To investigate this function, researchers should employ the following methodological approaches:

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation assays to confirm interaction between Syngr2 and viral proteins

    • Proximity ligation assays to visualize interactions in situ

    • FRET or BiFC for live-cell interaction dynamics

  • Functional impact assessment:

    • Generate stable knockdown cell lines using specific shRNAs targeting Syngr2

    • Develop overexpression systems using plasmid transfection

    • Quantify viral titers through plaque assays or qPCR at multiple time points post-infection

    • Measure viral RNA replication using strand-specific RT-qPCR

Experimental data indicates that Syngr2 knockdown significantly reduces viral titers. In one study, cells with Syngr2 silenced by shRNA showed markedly decreased viral replication compared to controls, while overexpression enhanced viral production .

What structural domains of Synaptogyrin-2 are critical for its protein-protein interactions, and how can these be investigated?

While detailed structural information on Synaptogyrin-2 domains is limited compared to some other synaptogyrin family members, its role in protein-protein interactions, particularly with viral proteins, suggests important functional domains.

To investigate the structural domains critical for protein-protein interactions:

  • Domain mapping:

    • Create truncated versions of Syngr2 to identify essential regions for interactions

    • Use site-directed mutagenesis to modify specific residues

    • Express these variants in cell systems and assess interaction capabilities

  • Structural analysis:

    • Employ X-ray crystallography or cryo-EM to determine 3D structure

    • Use computational modeling to predict interaction interfaces

    • Validate predictions through mutagenesis studies

By comparison, research on Synaptogyrin-3 has shown that specific domains are crucial for interactions with other proteins, such as Synapsin 2a, where the proline-rich domain H in the C-terminus of Syn2a interacts with amino acid residues 91-99 in Synaptogyrin-3 . Similar domain-specific interactions may exist for Synaptogyrin-2 and merit investigation.

What is the relationship between Synaptogyrin-2 and lipid droplet dynamics, and how can this be experimentally addressed?

Synaptogyrin-2 has been implicated in the reconstruction of lipid droplets into inclusion bodies during viral infection. This function suggests a previously uncharacterized role for Syngr2 in lipid metabolism or membrane dynamics .

To investigate this relationship experimentally:

  • Lipid droplet visualization and quantification:

    • Stain lipid droplets using BODIPY or Oil Red O in cells with normal, overexpressed, or knocked-down Syngr2

    • Use confocal microscopy to assess colocalization between Syngr2 and lipid droplets

    • Quantify number, size, and distribution of lipid droplets under different Syngr2 expression conditions

  • Molecular mechanisms:

    • Identify potential binding partners involved in lipid metabolism using mass spectrometry-based proteomics

    • Assess changes in lipid composition using lipidomics approaches

    • Investigate the involvement of specific lipid synthesis or transport pathways

Research has shown that during viral infection, Syngr2 transitions from a soluble fraction to an insoluble fraction, coinciding with its recruitment to lipid droplet-derived structures . This redistribution can be analyzed through subcellular fractionation followed by Western blotting.

What are the common challenges in detecting and quantifying Synaptogyrin-2 expression, and how can they be overcome?

Researchers frequently encounter several challenges when working with Synaptogyrin-2:

  • Low basal expression:

    • Under normal conditions, Syngr2 may be expressed at low levels in many cell types

    • Solution: Use sensitive detection methods such as qPCR for mRNA or amplified immunoassays for protein

  • Antibody specificity:

    • Cross-reactivity with other synaptogyrin family members

    • Solution: Validate antibodies using positive controls (overexpression systems) and negative controls (knockdown cells)

  • Subcellular localization changes:

    • Syngr2 redistributes between soluble and insoluble fractions under different conditions

    • Solution: Perform both whole-cell lysate analysis and subcellular fractionation

For accurate quantification, it is recommended to use multiple approaches:

MethodApplicationSensitivityLimitations
RT-qPCRmRNA expressionVery highDoes not reflect protein levels
Western blotProtein expressionModerateSemi-quantitative
ELISAProtein quantificationHighRequires specific antibodies
Mass spectrometryAbsolute quantificationVery highComplex methodology

Research has demonstrated that Syngr2 mRNA levels can increase dramatically (up to 275-fold) under certain conditions, necessitating a wide dynamic range for quantification methods .

How can researchers effectively design knockdown and overexpression systems for studying Synaptogyrin-2 function?

Designing effective genetic manipulation systems for Synaptogyrin-2 requires careful consideration of several factors:

For knockdown systems:

  • Design multiple shRNA or siRNA sequences targeting different regions of Syngr2 mRNA

  • Test knockdown efficiency using RT-qPCR and Western blot

  • Select the construct with highest efficiency and lowest off-target effects

  • For stable knockdown, package shRNA into lentiviral vectors for integration

Based on published research, shRNA targeting Syngr2 can achieve significant knockdown, with one study testing three different shRNAs and finding that shRNA2 was most effective at reducing both mRNA and protein levels .

For overexpression systems:

  • Clone the full-length mouse Syngr2 cDNA into appropriate expression vectors

  • Consider adding epitope tags (FLAG, HA) or fluorescent tags (GFP, mCherry) for detection

  • Optimize transfection conditions for the specific cell type

  • Validate expression using both fluorescence microscopy and Western blot

Successful overexpression can lead to 5-10 fold increases in Syngr2 levels, which has been shown to significantly enhance viral replication in infection models .

What is the potential role of Synaptogyrin-2 in neurological disorders, and how does it compare to other synaptogyrin family members?

While Synaptogyrin-2 is considered a non-neural member of the synaptogyrin family, emerging research suggests potential neurological implications. By comparison, Synaptogyrin-3 has been directly implicated in fear extinction mechanisms through its interaction with Synapsin 2a .

To investigate potential neurological roles of Syngr2:

  • Expression analysis:

    • Examine Syngr2 expression in various brain regions using RNA-seq or qPCR

    • Compare expression patterns with Syngr3 and other family members

    • Analyze expression changes in animal models of neurological disorders

  • Functional studies:

    • Generate conditional knockout mouse models to assess behavioral phenotypes

    • Investigate synaptic transmission in neurons with altered Syngr2 expression

    • Explore potential interactions with known neurological disease-associated proteins

The complex interaction between Synapsin 2a and Synaptogyrin-3 in the infralimbic cortex to basolateral amygdala circuit affects fear extinction, raising the possibility that Synaptogyrin-2 might have similar roles in specific neural circuits or under particular conditions .

How might Synaptogyrin-2 be exploited as a therapeutic target for viral infections, and what experimental approaches would validate this potential?

Given Synaptogyrin-2's role in promoting viral replication, particularly for SFTS bunyavirus, it represents a potential therapeutic target. By comparison, the interaction between Synapsin 2a and Synaptogyrin-3 has been targeted by ritonavir, an FDA-approved HIV drug, to disrupt their binding and rescue fear extinction behavior in mouse models .

To explore Syngr2 as a therapeutic target:

  • Target validation:

    • Confirm the essential role of Syngr2 in multiple viral infection models

    • Determine if temporary inhibition affects normal cellular functions

    • Evaluate potential compensation by other synaptogyrin family members

  • Drug discovery approaches:

    • Perform high-throughput screening to identify small molecules that disrupt Syngr2-viral protein interactions

    • Use structural information to design peptide inhibitors of key interaction domains

    • Repurpose existing drugs that might target Syngr2 or its interactions

  • Efficacy testing:

    • Evaluate candidates in cell culture infection models

    • Test promising compounds in animal models of viral infection

    • Assess potential synergistic effects with existing antiviral therapies

Therapeutic ApproachAdvantagesChallengesCurrent Research Stage
Small molecule inhibitorsEase of deliverySpecificity concernsEarly research
Peptide-based disruptionHigh specificityDelivery issuesTheoretical
RNA interferenceHighly specificDelivery to target tissuesProven in vitro
Antibody-based approachesTarget specificityLimited intracellular accessExploratory

The success of ritonavir in disrupting protein-protein interactions involving a related synaptogyrin family member suggests that similar approaches might be applicable to Synaptogyrin-2-mediated viral interactions .

What are the major knowledge gaps in our understanding of Synaptogyrin-2 function, and what methodological approaches might address these?

Despite growing research interest, several critical knowledge gaps remain in our understanding of Synaptogyrin-2:

  • Physiological function: While Syngr2's role in viral replication has been established, its normal physiological function remains poorly characterized. Future research should employ conditional knockout models coupled with comprehensive phenotyping to elucidate its native functions.

  • Tissue-specific roles: Given its non-neural classification but potential involvement in multiple systems, tissue-specific expression patterns and functions need further investigation through single-cell RNA sequencing and tissue-specific knockout models.

  • Structural information: Detailed structural data on Syngr2 and its interaction domains is lacking. X-ray crystallography, cryo-EM, and computational modeling approaches would provide valuable insights into its functional domains.

  • Regulation mechanisms: The factors controlling Syngr2 expression, particularly its dramatic upregulation during viral infection, remain unclear. Promoter analysis and epigenetic profiling would help identify relevant regulatory elements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.