Recombinant Mouse Synaptogyrin-3 (Syngr3)

Shipped with Ice Packs
In Stock

Description

Production and Delivery Systems

Recombinant SYNGR3 is engineered for in vivo and in vitro applications:

In Vivo Delivery

MethodConstructOutcome
AAV7 Viral VectorsSynapsin-I promoter-driven mouse Syngr3Increased striatal DA uptake in LRRK2 mutants .
MechanismNeuron-specific expression via Synapsin-I promoter ensures targeted expression in adult brains .

In Vitro Transfection

MethodConstructOutcome
pcDNA3.1 PlasmidFull-length human SYNGR3 cDNAEnhanced DA uptake in SH-SY5Y cells without altering DAT levels .
ToolsBamHI/XhoI restriction sites for cloning, Lipofectamine 2000 for transfection .

Role in Dopamine Regulation

Overexpression of SYNGR3 in LRRK2 mutant mice restores striatal dopamine uptake and improves behavioral deficits (e.g., marble burying) . This highlights its potential in PD models where dopamine depletion is central.

Tau-Induced Pathology

ModelInterventionOutcome
Tau P301S MiceHeterozygous Syngr3 knockoutRescued long-term synaptic plasticity and working memory .
MechanismSYNGR3 mediates Tau’s synaptic toxicity; reducing SYNGR3 prevents Tau-induced vesicle clustering and synaptic loss .

Synaptic Plasticity

ParameterWild-TypeTau P301STau P301S + Syngr3+/−
Mossy Fiber-CA3 SynapsesIntactReduced stratum lucidum areaRescued to wild-type levels .
GluK5/Nectin-3NormalDecreasedRestored .

Detection and Analysis Tools

Antibodies targeting SYNGR3 enable precise detection across species and applications:

Antibody TypeReactivityApplications
Rabbit PolyclonalMouse, Human, RatWB, IHC (paraffin/frozen), ICC .
Goat PolyclonalHumanELISA
AdvantagesHigh specificity for SYNGR3’s N-/C-terminal domains; validated in neurodegenerative models .

Parkinson’s Disease

  • Mechanism: SYNGR3 loss in LRRK2 mutants disrupts DAT-mediated dopamine recycling, exacerbating striatal dysfunction .

  • Therapeutic Potential: AAV7-mediated SYNGR3 overexpression restores dopamine uptake, suggesting gene therapy strategies .

Alzheimer’s Disease

  • Mechanism: SYNGR3 binds Tau at mossy fiber-CA3 synapses, impairing vesicle mobility and synaptic transmission .

  • Therapeutic Potential: Reducing SYNGR3 levels rescues cognitive deficits without affecting neuroinflammation, indicating synaptic-specific targets .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and additional fees are agreed upon in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
Syngr3; Synaptogyrin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Syngr3
Target Protein Sequence
MEGASFGAGRAGAAFDPVSFARRPQTLLRVVSWVFSIAVFGPIVNEGYVNSDSGPELRCV FNGNAGACRFGVVLGLGAFIACVAFLLLDVRFQQISSVRDRRRAVLLDLGFSGVWSFLWF VGFCFLTNQWQRTTPGPGTAQAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLF ATDQLGTGAAQAYPGYPVGSGVEGTETYQSPPFTETLDTSSKGYQVPAY
Uniprot No.

Target Background

Function
Synaptogyrin-3 may play a role in regulated exocytosis and indirectly modulate the activity of the plasma membrane dopamine transporter (SLC6A3), thereby influencing dopamine reuptake from the synaptic cleft into the presynaptic terminal.
Gene References Into Functions
  1. Synaptogyrin 3's association with synaptic vesicles and co-localization with synaptogyrin 1 in mouse brain synaptic vesicles has been demonstrated through subcellular fractionation and immunoprecipitation. PMID: 14755516
  2. A study revealed a novel interaction between the dopamine transporter (DAT) and synaptogyrin-3, suggesting a functional link between DAT and the vesicular dopamine system. PMID: 19357284
Database Links
Protein Families
Synaptogyrin family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse.
Tissue Specificity
Specifically expressed in brain. Found in the brain across the dorsal and ventral corpus striatum as well as in the cortex.

Q&A

What is Synaptogyrin-3 and where is it primarily expressed?

Synaptogyrin-3 (Syngr3) is a member of the synaptogyrin family of proteins that is especially abundant in the brain. Among the four homologues (Syngr1-4), Syngr3 is predominantly expressed in the central nervous system (CNS) . Similar to synaptophysin, Syngr3 is localized on synaptic vesicles as a membrane-spanning structural protein, suggesting a significant role in neurotransmission . Within the hippocampus, Syngr3 shows particularly strong enrichment in the stratum lucidum compared to other synaptogyrin family members, indicating a specialized function in this region .

How is Synaptogyrin-3 regulated at the transcriptional level?

Transcriptional regulation of Syngr3 involves several elements. In silico analysis of the 5′-flanking region of the Syngr3 gene has identified CpG-rich regions and transcriptional regulatory elements, including putative nerve growth factor-induced clone B (NBRE) response elements that bind nuclear receptor-related 1 (NURR1) protein . NURR1 plays a crucial role in the development of neuronal stem cells and survival of mature dopaminergic neurons, suggesting a regulatory pathway for Syngr3 expression that is linked to dopaminergic neuron health .

What are the best methods for overexpressing Synaptogyrin-3 in neuronal cell models?

For effective Syngr3 overexpression in neuronal cells, several validated methods exist:

Cell Culture Transfection Protocol:

  • Amplify full-length mouse Syngr3 cDNA using PCR with appropriate primers containing restriction enzyme sites

  • Subclone the PCR product into a mammalian expression vector (e.g., pcDNA3.1(+)) using restriction enzymes

  • Transform the plasmid into competent bacterial cells

  • Once the positive sequence is confirmed, transfect neuronal cells (e.g., differentiated SH-SY5Y cells) using Lipofectamine2000

  • Include empty vector-transfected cells as controls for all experiments

For in vivo applications, adeno-associated virus (AAV) vectors have proven effective for Syngr3 overexpression. Specifically, AAV7 encoding mouse Syngr3 under the control of the neuronal-specific Synapsin-I (SynI) promoter has been successfully used to induce neuron-specific transgene expression in adult rodent brain over extended periods .

What are reliable methods for detecting and quantifying Synaptogyrin-3 protein levels?

Multiple validated methods can be employed for Syngr3 detection and quantification:

Western Blot Protocol:

  • Lyse cells or tissue in RIPA buffer containing protease inhibitors

  • Incubate lysates on ice (20 min) and clarify by centrifugation (12,000 × g, 15 min, 4°C)

  • Determine protein concentration using Bradford assay

  • Separate proteins by SDS-PAGE and transfer to membranes

  • Block membranes and probe with anti-Syngr3 antibodies (e.g., Santa Cruz Biotechnology #sc-271046)

ELISA Quantification:
Commercial sandwich ELISA kits for mouse Syngr3 (e.g., MBS9327840; MyBiosource) offer a detection range of 3.12–100 ng/ml with approximately 1.0 ng/ml sensitivity .

Immunohistochemistry Protocol:

  • Perfuse animals with cold PBS followed by 4% paraformaldehyde

  • Post-fix brain tissue overnight at 4°C

  • Dehydrate and embed in paraffin

  • Section coronally at 8 μm thickness

  • Perform antigen retrieval and incubate with anti-Syngr3 antibody (1:200)

  • Visualize using fluorophore-conjugated secondary antibodies

  • Examine under confocal microscope

How does Synaptogyrin-3 expression change in Parkinson's disease models?

In Parkinson's disease models, particularly those involving LRRK2 mutations, Syngr3 expression shows significant alterations. Young LRRK2 mutant mice (R1441G knockin) exhibit significantly lower Syngr3 levels in the striatum compared to age-matched wild-type controls, resembling levels observed in aged wild-type mice . This reduction parallels findings in human PD brains, where reduced Syngr3 expression has been reported . Similar reduction was also observed in an MPTP mouse model of PD, suggesting this phenomenon may be consistent across different PD models .

The table below summarizes Syngr3 expression changes in various disease models:

Disease/ModelSyngr3 ExpressionReference
Human PD brainsReducedSimunovic et al., 2009
LRRK2 R1441G miceReduced in striatumLi et al., 2022
MPTP mouse modelReducedMiller et al., 2004
Alzheimer's diseaseReducedSaetre et al., 2011
Tau P301S miceNormal, but co-localizes with pathogenic TauMcInnes et al., 2018

What experimental approaches demonstrate functional Synaptogyrin-3 interactions with dopamine transporters?

To establish the functional interaction between Syngr3 and dopamine transporters (DAT), researchers have employed multiple complementary techniques:

  • Co-localization Studies:

    • Immuno-gold transmission electron microscopy and immunohistochemistry have visualized spatial co-localization of Syngr3 with DAT at striatal presynaptic terminals

  • Protein-Protein Interaction Validation:

    • Co-immunoprecipitation using striatal tissue has confirmed direct protein-protein interaction between Syngr3 and DAT

    • The interaction protocol involves:
      a) Preparing striatal lysates with protease inhibitors
      b) Clarifying lysates by centrifugation
      c) Incubating with antibodies against either Syngr3 or DAT
      d) Analyzing precipitated complexes by Western blot

  • Functional Assays:

    • Cellular dopamine uptake assays using differentiated SH-SY5Y cells demonstrate that transient overexpression of Syngr3 increases dopamine uptake activity without affecting total DAT levels

    • Ex vivo synaptosomal dopamine uptake experiments show that AAV-mediated Syngr3 overexpression in striatum increases dopamine uptake in LRRK2 mutant mice

How does genetic manipulation of Synaptogyrin-3 affect behavioral phenotypes in neurodegenerative disease models?

Genetic manipulation of Syngr3 has demonstrated significant effects on behavioral phenotypes in multiple disease models:

In LRRK2 Parkinson's Disease Models:
AAV-mediated Syngr3 overexpression in the striatum of LRRK2 R1441G mutant mice not only increased ex vivo synaptosomal dopamine uptake but also improved innate marble burying behavior . These findings suggest that restoring Syngr3 levels can ameliorate certain behavioral deficits associated with this PD model.

In Tau-Associated Models:
Heterozygous knockout of Syngr3 (Syngr3+/-) in Tau P301S mice (a model for tauopathies) significantly rescued:

  • Long-term synaptic plasticity defects at mossy fiber-CA3 synapses

  • Working memory deficits, as evidenced by improved performance in spatial memory tasks

  • Both pre- and post-synaptic loss

Intriguingly, while Syngr3 reduction rescued synaptic and cognitive phenotypes, it did not affect neuroinflammation in Tau P301S mice, suggesting independent pathways for Tau-induced synaptic dysfunction and inflammatory responses .

What is the relationship between Synaptogyrin-3 and pathogenic Tau protein?

Under pathogenic conditions, Syngr3 serves as a receptor for Tau at pre-synaptic terminals . In 6-month-old Tau P301S mice, there is strong accumulation of Tau in the stratum lucidum of the hippocampus, with extensive co-labeling of Tau and Syngr3 at mossy fiber-CA3 synapses .

Isolation of mossy fiber-CA3 synaptosomes from Tau P301S mice confirms that these structures are positive for both Syngr3 and Tau, with strong co-localization between the two proteins . This physical interaction appears functionally significant, as reducing Syngr3 levels in Tau P301S mice by breeding them with Syngr3+/- mice corrects long-term plasticity defects and prevents synaptic loss .

The rescue effect is specific to synaptic pathology, as Tau protein expression remains unchanged in Tau P301S;Syngr3+/- mice compared to Tau P301S littermates, suggesting that Syngr3 reduction does not affect Tau expression but rather modifies its synaptotoxic effects .

What are common pitfalls in generating and validating Synaptogyrin-3 knockout models?

When generating and validating Syngr3 knockout models, researchers should be aware of several potential challenges:

What methodological considerations are important for studying Synaptogyrin-3 involvement in synaptic vesicle dynamics?

Investigating Syngr3's role in synaptic vesicle dynamics requires specific methodological considerations:

What are promising therapeutic strategies targeting Synaptogyrin-3 in neurodegenerative diseases?

Based on current research, several therapeutic strategies targeting Syngr3 show promise for neurodegenerative diseases:

What unresolved questions remain about Synaptogyrin-3's role in synaptic function and neurodegeneration?

Despite significant advances, several critical questions about Syngr3 remain unanswered:

  • Molecular Mechanism of Dopamine Transport Regulation:
    While Syngr3 is known to interact with DAT and facilitate dopamine uptake, the precise molecular mechanisms underlying this functional relationship remain unclear. Does Syngr3 affect DAT trafficking, its conformation, or its interaction with other proteins?

  • Context-Dependent Effects:
    Why does Syngr3 exhibit apparently opposing roles in different disease contexts? Understanding the molecular basis for its protective effect when upregulated in LRRK2 models versus its detrimental effect in Tau pathology models could reveal important insights about disease-specific mechanisms.

  • Relationship with Other Synaptogyrin Family Members:
    Despite structural similarities, Syngr3 appears to have distinct functions from Syngr1 in the CNS. The extent of functional redundancy versus specialization among synaptogyrin family members requires further investigation, particularly in pathological states.

  • Potential Role in Cocaine Addiction:
    Preliminary evidence suggests Syngr3 involvement in cocaine addiction and dopamine deficits , but the mechanisms underlying this relationship and potential therapeutic implications remain to be fully explored.

  • Transcriptional and Post-translational Regulation:
    The identification of NURR1 binding elements in the Syngr3 promoter region suggests specific transcriptional regulation , but how this regulation changes during development, aging, and disease progression is not fully understood. Similarly, potential post-translational modifications of Syngr3 that might affect its function have not been comprehensively characterized.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.