Recombinant Mouse Synaptophysin-like protein 1 (Sypl1)

Shipped with Ice Packs
In Stock

Description

Functional Roles

Sypl1 participates in synaptic vesicle (SV) cycling and cellular stress responses:

Vesicle Trafficking

  • Interacts with synaptobrevin (Syb) and dynamin, implicating it in SV endocytosis .

  • Forms voltage-dependent channels in lipid bilayers, analogous to gap junctions .

Apoptosis Regulation

  • Overexpression suppresses apoptosis by inhibiting ROS-induced ERK activation .

  • Knockdown increases ROS levels, leading to sustained ERK phosphorylation and cell death .

Oxidative Stress Response

  • Positively correlates with antioxidant pathways (e.g., pentose phosphate pathway) .

  • Modulates NADPH production via G6PD and PGD enzymes .

Table 1: Sypl1 in Pancreatic Ductal Adenocarcinoma (PDAC)

ParameterObservationSource
SYPL1 expressionUpregulated in PDAC tumors; correlates with poor prognosis
Proliferation impactPromotes tumor growth in vitro and in vivo (mouse xenograft models)
Apoptosis regulationReduces cisplatin-induced apoptosis by 40% in overexpression models
ERK pathway interactionSilencing Sypl1 activates ERK, increasing apoptosis; rescued by selumetinib

Table 2: Chemical Interactions with Sypl1

CompoundEffect on Sypl1Source
Benzo[a]pyreneBinds to Sypl1 promoter, increasing expression
CadmiumUpregulates Sypl1 mRNA
Bisphenol AMixed effects (increased/decreased expression depending on context)
Hydrogen peroxideMimics Sypl1 knockdown, elevating ROS and ERK activation

Biomedical Applications

  • Neuroendocrine Tumor Biomarker: Sypl1 antibodies are widely used to diagnose neuroendocrine tumors due to its synaptic vesicle localization .

  • Therapeutic Target: In PDAC, targeting Sypl1’s anti-apoptotic effects could sensitize tumors to chemotherapy .

Outstanding Questions

  • Does recombinant mouse Sypl1 form similar hexameric channels in vivo as observed in vitro?

  • How do phosphorylation events at the C-terminus regulate its interaction with SNARE proteins?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while the shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
Sypl1; Pphn; Sypl; Synaptophysin-like protein 1; Pantophysin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Sypl1
Target Protein Sequence
MASKANMVRQRFSRLSQRMSAFQINLNPLKEPLGFIKILEWFASIFAFATCGGFKGKTEI QVNCPKVGVNKNQTVTATFGYPFRLNQASFHTPPNVSVCDVNWEKHVLIGDYSSSAQFYV TFAVFVFLYCIAALLLYVGYTNLYRDSRKLPMIDFIVTLVATFLWLVSSSAWAKALTDIK VATGHRIVEELEICNPESGVSCYFVSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSL HSPSNTSASHSQGGGPPTSGM
Uniprot No.

Target Background

Database Links
Protein Families
Synaptophysin/synaptobrevin family
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Melanosome. Note=Cytoplasmic transport vesicles.
Tissue Specificity
Ubiquitously expressed.

Q&A

What is Synaptophysin-like protein 1 (Sypl1) and how does it differ from Synaptophysin?

Sypl1 is a member of the MARVEL domain family of integral membrane proteins, similar to Synaptophysin (Syp). While Synaptophysin is primarily involved in synaptic vesicle trafficking and neurotransmitter release, Sypl1 has broader tissue distribution and functions. Synaptophysin forms hexameric structures resembling an open basket with a large pore, participating in membrane fusion and recycling events regulated by interactions with SNARE machinery . In contrast, Sypl1 has been implicated in tumor progression and apoptosis regulation, particularly in pancreatic ductal adenocarcinoma and hepatocellular carcinoma .

The molecular weight of Synaptophysin is typically observed at 38-40 kDa (calculated 34 kDa) , while recombinant Sypl1 molecular characteristics must be validated in each expression system.

What expression systems are most effective for producing recombinant mouse Sypl1?

For recombinant mouse Sypl1 production, both prokaryotic and eukaryotic expression systems can be employed, with each offering distinct advantages:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, rapid productionLacks post-translational modifications, potential misfoldingStructural studies, antibody production
Mammalian cells (HEK293, CHO)Native-like folding, post-translational modificationsLower yield, higher costFunctional assays, protein-protein interaction studies
Insect cells (Sf9, Sf21)High expression levels, some post-translational modificationsModerate cost, glycosylation differs from mammalianStructural and biochemical studies

For functional studies, mammalian expression systems are preferred due to their ability to produce properly folded and modified Sypl1 protein, especially when studying interactions with other membrane proteins.

What are optimal storage conditions for maintaining recombinant Sypl1 stability?

Based on storage protocols for similar proteins, recombinant Sypl1 stability can be maintained with the following conditions:

  • Storage buffer: PBS with 0.02% sodium azide and 50% glycerol at pH 7.3

  • Temperature: -20°C for long-term storage

  • Stability: Approximately one year after shipment when properly stored

  • Aliquoting: Recommended for proteins intended for multiple uses, though unnecessary for -20°C storage of small volumes

For proteins containing transmembrane domains like Sypl1, adding stabilizers such as mild detergents (0.1% DDM or 0.05% LMNG) may help maintain native conformation.

What are the validated applications for recombinant mouse Sypl1 in research?

Recombinant Sypl1 can be utilized in various experimental applications:

ApplicationMethodologyRecommended Conditions
Western Blot (detection control)Use as positive control50-100 ng per lane
Immunoprecipitation validationSpike-in experiments0.5-4.0 μg per 1.0-3.0 mg total protein lysate
Functional assaysIn vitro vesicle traffickingRecombinant protein integration into artificial liposomes
ROS/ERK pathway studiesCell treatment with recombinant protein50-200 ng/ml, 24-48h incubation
Protein-protein interaction studiesPull-down assays, SPRBuffer optimization critical for membrane protein

When using recombinant Sypl1 as a standard or control, researchers should validate its behavior against endogenous protein, particularly when studying membrane association properties.

How can researchers effectively validate the specificity of anti-Sypl1 antibodies?

Antibody validation for Sypl1 research requires multiple approaches:

  • Positive controls: Test antibodies using recombinant Sypl1 protein and tissues/cells known to express Sypl1 (pancreatic tissue, brain tissue)

  • Negative controls: Include Sypl1 knockout/knockdown samples

  • Cross-reactivity testing: Evaluate potential cross-reactivity with Synaptophysin and other MARVEL domain proteins

  • Multiple application validation: Verify antibody performance across multiple applications (WB, IP, IHC, IF/ICC)

Comprehensive validation data for related synaptophysin antibodies show successful detection in various sample types:

Sample TypeDetection MethodSuccessful Applications
PC-12 cellsWestern Blot1:5000-1:50000 dilution
Mouse brain tissueIP, IHC0.5-4.0 μg for IP; 1:500-1:2000 for IHC
Mouse pancreas tissueIF-P1:200-1:800 dilution
Cell lines (U2OS, A549)IF/ICC, FC (Intra)1:200-1:800 for IF/ICC; 0.25 μg per 10^6 cells for FC

Similar validation protocols should be applied to Sypl1-specific antibodies .

What are the key considerations for designing Sypl1 knockout/knockdown experiments?

When designing genetic manipulation experiments targeting Sypl1:

  • Knockout strategies:

    • CRISPR/Cas9 approaches should target exons encoding critical functional domains

    • Consider conditional knockouts to study tissue-specific effects

    • Validate knockout efficiency at both mRNA and protein levels

  • Knockdown approaches:

    • siRNA targeting: Validated sequences such as "CCTCATAGGCGATTACTCT" have been used for effective SYPL1 knockdown

    • shRNA for stable knockdown: Lentiviral delivery systems provide sustained suppression

    • Consider rescue experiments with recombinant protein to confirm specificity

  • Phenotype assessment:

    • In cancer models, assess proliferation (CCK8 assay), colony formation, and apoptosis (flow cytometry)

    • In neuronal models, examine membrane trafficking and electrophysiological properties

    • Evaluate ROS levels and ERK activation, as these pathways are regulated by Sypl1

What mechanisms explain Sypl1's role in cancer progression?

Sypl1 promotes cancer progression through several interconnected mechanisms:

  • Inhibition of apoptosis: SYPL1 protects cancer cells from apoptosis by suppressing ROS-induced ERK activation. When SYPL1 is knocked down, sustained ERK activation leads to cell death .

  • Regulation of oxidative stress: SYPL1 expression positively correlates with antioxidant activity and the pentose phosphate pathway (PPP). Key findings include:

    • Positive correlation between SYPL1 and PPP enzymes G6PD and PGD at the transcriptional level

    • Association with peroxisome function and antioxidant activity

    • SYPL1 knockdown increased ROS levels in cancer cells

  • Correlation with anti-apoptotic genes: SYPL1 expression positively correlates with anti-apoptotic genes including BIRC5, XIAP, MCL1, BCL2L1, PIK3CB, CFLAR, and CAPN2 .

  • Association with epithelial-mesenchymal transition: In hepatocellular carcinoma, SYPL1 overexpression correlates with EMT markers, potentially facilitating cancer cell invasion and metastasis .

How does Sypl1 expression correlate with clinical outcomes in cancer patients?

Clinical data demonstrates significant correlations between SYPL1 expression and patient outcomes:

In Pancreatic Ductal Adenocarcinoma (PDAC):

  • High SYPL1 expression is associated with poor prognosis (HR: 2.807, 95% CI: 1.204-6.543, p=0.017)

  • SYPL1 expression is significantly upregulated in tumor tissue compared to adjacent normal tissue

  • Multivariate analysis confirms SYPL1 as an independent prognostic factor

Clinical-pathological correlation in PDAC patients:

Clinicopathological featuresnSYPL1 expressionp-values
Sex (Male/Female)45/33Low (n=30)/High (n=48)0.744
Age-58.000±9.229/59.042±11.1230.669
Tumor site (Head/Body and tail)65/1324:41/6:70.532
Grade (Moderate to good/Poor to poor-moderate)35/3912:23/17:220.607
Tumor diameter (cm)-4.0 (3.0–5.0)/3.0 (3.0–4.5)0.31
Tumor extends beyond pancreas (Presence/Absence)62/1225:37/4:80.767

In hepatocellular carcinoma, similar patterns of poor prognosis with high SYPL1 expression have been reported .

What experimental approaches have been used to study Sypl1's role in the ROS/ERK pathway?

Research into Sypl1's regulation of the ROS/ERK pathway has employed several methodological approaches:

  • ROS measurement:

    • Flow cytometry using ROS-sensitive fluorescent probes

    • Treatment with hydrogen peroxide (H₂O₂) to mimic the effect of SYPL1 knockdown on ROS levels

  • ERK activation assessment:

    • Western blot analysis of phosphorylated ERK (pERK) levels

    • Use of ERK inhibitors (Selumetinib) to counteract ERK activation and prevent cell death in SYPL1-knockdown cells

    • Time-course experiments to distinguish between transient and sustained ERK activation

  • Antioxidant pathway analysis:

    • Gene Set Enrichment Analysis (GSEA) to correlate SYPL1 expression with oxidative stress response pathways

    • Gene Set Variation Analysis (GSVA) to calculate pathway activity

    • Analysis of correlation between SYPL1 and enzymes involved in NADPH production (G6PD, PGD)

    • Evaluation of peroxisome function and antioxidant genes

  • Rescue experiments:

    • Restoration of SYPL1 expression in knockdown cells to reverse ROS elevation

    • Application of antioxidants to counteract the effects of SYPL1 knockdown

How can researchers address technical challenges in studying membrane-associated proteins like Sypl1?

Membrane protein research presents unique challenges that can be addressed through specialized techniques:

  • Solubilization strategies:

    • Screen detergents systematically (DDM, LMNG, CHAPS) for optimal solubilization

    • Consider native nanodiscs or styrene maleic acid lipid particles (SMALPs) to maintain native lipid environment

    • Implement detergent exchange during purification to improve stability

  • Structural studies:

    • Synaptophysin has been studied using electron microscopy, revealing a hexameric structure resembling an open basket

    • Similar approaches could be applied to Sypl1, potentially revealing functional differences

    • Consider cryo-EM for high-resolution structural determination

  • Functional reconstitution:

    • Develop proteoliposome systems to study Sypl1's membrane function

    • Validate proper protein orientation and function after reconstitution

    • Employ fluorescence-based assays to monitor vesicle trafficking events

  • In situ analysis:

    • Super-resolution microscopy to visualize Sypl1 localization in native membranes

    • FRET-based approaches to study protein-protein interactions in membrane environments

    • Proximity labeling methods (BioID, APEX) to identify interacting partners

What methodological approaches can reconcile contradictory findings regarding Sypl1 function?

When addressing contradictory results in Sypl1 research:

  • Context-dependent analysis:

    • Systematically compare experimental conditions across studies (cell types, culture conditions, experimental timeframes)

    • Evaluate tissue-specific differences in Sypl1 function

    • Consider developmental timing, as Sypl1's role may change during different developmental stages

  • Isoform-specific investigations:

    • Determine if different splice variants or isoforms are being studied

    • Design experiments to specifically target individual isoforms

    • Analyze co-expression patterns with related proteins

  • Rigorous controls:

    • Include both positive and negative controls in all experiments

    • Validate antibody specificity across experimental conditions

    • Use multiple methodological approaches to confirm findings

  • Pathway integration:

    • Consider Sypl1's function within broader signaling networks

    • Evaluate compensatory mechanisms that may mask phenotypes

    • Examine temporal dynamics of signaling cascades downstream of Sypl1

How can researchers distinguish between Sypl1's direct effects and indirect consequences of its manipulation?

To differentiate between direct and indirect effects:

  • Temporal analysis:

    • Conduct time-course experiments following Sypl1 manipulation

    • Identify immediate (likely direct) versus delayed (potentially indirect) responses

    • Use rapid induction systems (e.g., optogenetics, chemical induction) for temporal control

  • Domain-specific mutations:

    • Generate mutants affecting specific functional domains of Sypl1

    • Create chimeric proteins by swapping domains with related proteins

    • Employ structure-guided mutagenesis to target interaction interfaces

  • Direct binding assays:

    • Surface plasmon resonance (SPR) or microscale thermophoresis to detect direct interactions

    • In vitro reconstitution with purified components

    • Proximity ligation assays in cellular contexts

  • Systems-level analysis:

    • RNA-seq following Sypl1 manipulation at multiple timepoints

    • Proteomics approaches to identify changes in protein-protein interactions

    • Network analysis to distinguish primary from secondary effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.