Recombinant Mouse Synaptophysin-like protein 2 (Sypl2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Synaptophysin-like Protein 2 (Sypl2)

Recombinant Mouse Synaptophysin-like protein 2 (Sypl2), also known as Mitsugumin 29 (MG29), is a transmembrane protein critical for calcium signaling and excitation-contraction coupling in skeletal muscle. It belongs to the synaptophysin/synaptobrevin family and shares structural homology with synaptic vesicle proteins. Recombinant Sypl2 is engineered for research purposes, enabling functional studies on its role in muscle physiology and disease contexts, including cancer.

Molecular Profile

AttributeDetail
Gene NameSypl2 (Mouse: Sypl2; Human: SYPL2)
Protein Length264–272 amino acids (mouse), 272 amino acids (human)
Molecular WeightCalculated: ~30 kDa; Observed: ~68 kDa (post-translational modifications)
IsoformsTwo known isoforms; recombinant proteins typically span AA 1–264/272
Subcellular LocalizationIntegral membrane protein; enriched in skeletal muscle triad junctions

Sypl2 regulates intracellular calcium homeostasis by interacting with ryanodine receptors (RyR) and influencing store-operated calcium entry (SOCE). Its dysfunction is linked to muscle fatigue and structural defects in triad junctions .

Functional Studies

Recombinant Sypl2 is used to:

  1. Investigate Calcium Signaling: Co-expression with RyR in vitro models induces apoptosis via calcium depletion, mimicking muscle fatigue .

  2. Assess Drug Targets: Evaluates interactions with anti-cancer therapies (e.g., bevacizumab) in colorectal cancer (CRC) models .

Detection and Quantification

Assay TypeReagentsSample TypesSensitivityReferences
ELISAAnti-Sypl2 antibodies (e.g., MBS9332638)Tissue homogenates, seraNative Sypl2 detection
Western BlotPolyclonal/rabbit monoclonal antibodies (e.g., SAB3500069)Cell lysates, recombinant proteins~30–68 kDa bands

Muscle Physiology

  • Sypl2 Knockout Models: Mice exhibit reduced muscle contractile force, altered triad junctions, and increased fatigue susceptibility .

  • Calcium Dynamics: Sypl2 modulates RyR-mediated calcium release, critical for excitation-contraction coupling .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify your needs during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sypl2; Mg29; Synaptophysin-like protein 2; Mitsugumin-29; Mg29
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Sypl2
Target Protein Sequence
MSSTESPGRTSDKSPRQQVDRLLLGLRWQRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET GALVLCNNEAKDVSSIIVLFGYPFRLYQVQYEMPLCDQDSTSKTMNLMGDFSAPAEFFVT LGIFSFFYTMAALVIYLRFHKLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANLSVLFGFINFFLWAGNCWFVFKETPWH GQGQDQGQGPSQESAAEQGAVEKQ
Uniprot No.

Target Background

Function
Synaptophysin-like protein 2 (Sypl2) plays a crucial role in facilitating communication between the T-tubular and junctional sarcoplasmic reticulum (SR) membranes.
Gene References Into Functions
  1. Calcium transients in skeletal muscle are regulated via interaction between Mg29 and TRPC3. PMID: 26141232
  2. Research suggests that slow cumulative calcium entry through store-operated calcium channels (SOCs) is essential for long-term calcium homeostasis, such that reduced SOC activity exacerbates muscle fatigue during intensive exercise. PMID: 11988740
  3. MG29 does not participate in the activation of store-operated Ca2+ entry, contradicting previous findings with immature muscles. PMID: 14559251
Database Links
Protein Families
Synaptophysin/synaptobrevin family
Subcellular Location
Membrane; Multi-pass membrane protein. Note=Triad junction, the junctional complex between the transverse tubule and the sarcoplasmic reticulum.
Tissue Specificity
Expressed abundantly in skeletal muscle and at lower levels in the kidney.

Q&A

How does Synaptophysin-like protein 2 (Sypl2) differ structurally and functionally from other synaptophysin family members?

Synaptophysin-like protein 2 (Sypl2) belongs to the synaptophysin family, which includes Synaptophysin (SYP) and Synaptophysin 2 (Synaptoporin/SYNPR). While sharing structural similarities, these proteins have distinct expression patterns and functions:

  • Synaptophysin (SYP): A major synaptic vesicle protein p38 that is ubiquitously expressed throughout neuronal tissues. It is involved in organizing membrane components and targeting vesicles to the plasma membrane. This protein also regulates short-term and long-term synaptic plasticity .

  • Synaptophysin 2 (Synaptoporin/SYNPR): Primarily concentrated in the mossy fiber synapses of the hippocampus, unlike the ubiquitously expressed Synaptophysin 1. It functions as a component of the synaptic vesicle membrane and plays an important role in synaptic vesicle trafficking .

  • Synaptophysin-like protein 2 (Sypl2): Often expressed in non-neuronal tissues, particularly in muscle, demonstrating its specialized functions outside the central nervous system.

The primary structural difference lies in the C-terminal regions, which show the greatest sequence divergence among family members, making this region ideal for antibody targeting for specific detection.

What are the optimal storage conditions for maintaining recombinant mouse Sypl2 stability?

To maintain stability of recombinant mouse Sypl2:

  • Temperature: Storage at -20°C is recommended for long-term preservation .

  • Buffer composition: Optimal buffer consists of 10 mM HEPES (pH 7.5), 150 mM NaCl, 100 μg per ml BSA, and 50% glycerol .

  • Aliquoting: Prepare small aliquots to avoid repeated freeze-thaw cycles, as the presence of 50% glycerol allows taking aliquots without complete thawing .

  • Stability duration: When properly stored, recombinant Sypl2 remains stable for at least 1 year at -20°C .

Storage ParameterRecommended ConditionNotes
Temperature-20°CFor long-term storage
Buffer10 mM HEPES (pH 7.5), 150 mM NaCl, 100 μg/ml BSA, 50% glycerolGlycerol acts as cryoprotectant
Shipping conditionBlue IceFor maintaining cold chain
Stability periodAt least 1 yearAt recommended storage conditions

What antibody dilutions are recommended for detecting mouse Sypl2 in different experimental applications?

Based on experimental protocols for synaptophysin family proteins, the following dilutions are recommended:

ApplicationRecommended DilutionTissue/Sample Type
Western Blotting (WB)1:1000Brain tissue
Immunocytochemistry (ICC)1:100Cell cultures
Immunohistochemistry (IHC)Not specifically listed for Sypl2, but similar to Synaptophysin antibodiesMouse tissue sections

When working with anti-Synaptophysin 2 antibodies, which are structurally similar to Sypl2, researchers should validate specificity as these antibodies are designed to detect endogenous levels of the ~38 kDa protein .

What expression systems are most effective for producing functional recombinant mouse Sypl2?

When designing expression systems for recombinant mouse Sypl2, researchers should consider:

Mammalian Expression Systems:

  • Advantages: Proper post-translational modifications and protein folding

  • Cell lines: HEK293 or CHO cells typically yield functional membrane proteins

  • Vector design: Include a signal peptide sequence to ensure proper membrane insertion

  • Purification tags: N-terminal tags are preferable as they generally interfere less with membrane insertion

Bacterial Expression Systems:

  • Limitations: As a membrane protein, Sypl2 may form inclusion bodies in E. coli

  • Solutions: Use specialized strains designed for membrane protein expression

  • Solubility enhancement: Consider fusion with solubility-enhancing tags like MBP or SUMO

The choice between expression systems should be guided by the intended application, with mammalian systems generally preferred for functional studies.

How can researchers distinguish between Sypl2 and other closely related synaptophysin family members in tissue samples?

Distinguishing between synaptophysin family members requires careful selection of detection methods:

Antibody-based approaches:

  • Use antibodies generated against unique C-terminal peptide sequences, as employed for Synaptophysin 2

  • Perform antibody validation using tissues known to differentially express family members

  • Include appropriate controls when performing Western blot or immunohistochemistry

PCR-based detection:

  • Design primers targeting regions with minimal sequence homology

  • Validate primer specificity using recombinant standards for each family member

  • Perform melt curve analysis to confirm amplification of a single product

Protein characteristics for differentiation:

  • Molecular weight: Sypl2 (~38 kDa) may be distinguished from other family members by precise SDS-PAGE analysis

  • Expression patterns: Utilize tissue-specific expression differences (e.g., Synaptophysin 2 is concentrated in mossy fiber synapses of the hippocampus)

How can researchers effectively use recombinant mouse Sypl2 in genetic association studies?

For genetic association studies involving Sypl2:

eQTL Analysis Approaches:

  • Design studies to identify genetic variants associated with Sypl2 expression

  • Use liver samples for eQTL studies, as previously demonstrated for SYPL2 expression analysis

  • Consider conditional analysis on top eQTL-associated SNPs (e.g., rs2359653 has been identified in SYPL2 studies)

Statistical Considerations:

  • Apply Bayesian tests for colocalization between pairs of genetic associations

  • Utilize stepwise regression strategies to reveal secondary association signals

  • Implement quality control methods like DENTIST to detect and eliminate errors in GWAS or LD reference data

Visualization of Results:

  • Plot -log10(p) association values against chromosomal position

  • Create separate plots for Sypl2 expression and phenotypic traits of interest

  • Generate conditional p-value plots to identify independent signals

Analysis TypeRecommended ApproachStatistical Method
Primary eQTL identificationGenome-wide association-log10(p) value calculation
Conditional analysisStepwise regressionConditional p-values
Colocalization testingBayesian methodsBayes factors calculation
GWAS error reductionDENTISTχ² distribution with 1 degree of freedom

What are the methodological considerations when studying Sypl2 interactions with other synaptic proteins?

When investigating protein interactions involving Sypl2:

In vitro interaction studies:

  • Use purified recombinant Sypl2 as bait in pull-down assays

  • Conduct co-immunoprecipitation experiments in relevant tissue/cell lysates

  • Apply crosslinking approaches to capture transient interactions

Functional validation methods:

  • Develop reporter assays to measure impact of interactions on cellular processes

  • Utilize mutagenesis to identify specific binding domains

  • Perform competitive binding assays to determine binding affinities

Proteomic approaches:

  • Apply mass spectrometry to identify novel interaction partners

  • Use proximity labeling techniques to capture the Sypl2 interactome in living cells

  • Validate findings with orthogonal methods like in situ proximity ligation assays

How should researchers approach experimental design when investigating differential expression of Sypl2 across tissue types?

For tissue-specific expression studies:

Sample preparation:

  • Collect multiple tissue types from the same experimental animals to control for individual variation

  • Preserve samples appropriately for both protein and RNA extraction

  • Consider developmental timepoints, as expression patterns may change during development

Quantification methods:

  • For protein: Western blotting with antibody dilution of 1:1000

  • For mRNA: qRT-PCR with validated Sypl2-specific primers

  • For localization: Immunohistochemistry with antibody dilution of 1:100

Controls and normalization:

  • Include samples from tissues known to express Sypl2 at different levels

  • Use multiple housekeeping genes/proteins for normalization

  • Validate findings using multiple detection methods

How can researchers resolve discrepancies in Sypl2 expression data between different detection methods?

When facing inconsistent results:

Common sources of discrepancy:

  • Antibody cross-reactivity with other synaptophysin family members

  • Differences in sample preparation affecting epitope accessibility

  • Variations in quantification methods and normalization approaches

Resolution strategies:

  • Compare results using multiple antibodies targeting different epitopes

  • Validate antibody specificity using recombinant standards

  • Implement multiple detection methods (protein, mRNA, activity)

  • Perform spike-in controls with recombinant Sypl2 to calibrate detection sensitivity

Statistical approaches:

  • Apply multiple regression models to identify variables affecting detection

  • Use Bland-Altman plots to visualize systematic differences between methods

  • Consider meta-analysis approaches when integrating data from multiple sources

What are the most common pitfalls when working with recombinant mouse Sypl2 and how can they be addressed?

Common challenges and solutions include:

ChallengeCauseSolution
Low expression yieldMembrane protein natureOptimize codon usage; use specialized expression hosts
Protein aggregationImproper foldingInclude stabilizing agents; optimize purification conditions
Loss of functionDenaturation during purificationUse mild detergents; maintain cold chain throughout
Poor antibody recognitionConformational epitopesUse multiple antibodies; consider non-denaturing detection methods
Non-specific interactionsCross-reactivityPerform competition assays; increase stringency of wash buffers

How should researchers interpret and analyze GWAS and eQTL data related to Sypl2 expression?

For genomic data analysis:

Quality control measures:

  • Apply DENTIST methodology to leverage LD among genetic variants and eliminate errors in GWAS or LD reference data

  • Evaluate heterogeneity between GWAS and LD reference samples

  • Filter variants based on imputation quality and minor allele frequency

Analytical approaches:

  • Use conditional analysis to identify independent signals associated with Sypl2 expression

  • Apply colocalization testing to determine if the same variant affects both expression and phenotype

  • Consider linkage disequilibrium when interpreting nearby genetic associations

Interpretation frameworks:

  • Evaluate both cis and trans regulatory effects on Sypl2 expression

  • Consider tissue-specific eQTL effects, as demonstrated in liver samples

  • Integrate findings with other omics data for comprehensive understanding

What emerging technologies show promise for advancing Sypl2 functional studies?

Novel research approaches that may enhance understanding of Sypl2 include:

Advanced imaging techniques:

  • Super-resolution microscopy to visualize Sypl2 localization at the nanoscale

  • Live-cell imaging with fluorescently tagged Sypl2 to track dynamics in real-time

  • Correlative light and electron microscopy to relate function to ultrastructure

Genome editing approaches:

  • CRISPR-Cas9 modification of endogenous Sypl2 with reporter tags

  • Creation of conditional knockout models for tissue-specific functional analysis

  • Base editing for introducing specific mutations to study structure-function relationships

Systems biology integration:

  • Multi-omics approaches combining genomics, transcriptomics, and proteomics

  • Network analysis to position Sypl2 within relevant cellular pathways

  • Mathematical modeling of Sypl2 contributions to cellular functions

How can researchers effectively design experiments to distinguish between the roles of Sypl2 and other synaptophysin family members?

Strategic experimental design is crucial for functional differentiation:

Comparative expression studies:

  • Parallel analysis of multiple family members across tissues and developmental stages

  • Creation of comprehensive expression atlases with spatial and temporal resolution

  • Correlation of expression patterns with functional readouts

Rescue experiments:

  • Knockout of individual family members followed by rescue with others

  • Expression of chimeric proteins to identify functional domains

  • Conditional expression systems to control timing and levels of expression

Interaction profiling:

  • Comparative interactomics to identify shared and unique binding partners

  • Competition assays to determine relative binding affinities

  • Structural studies to elucidate binding interfaces

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.