Recombinant Mouse Synaptoporin (Synpr)

Shipped with Ice Packs
In Stock

Description

Synaptic Plasticity and Mossy Fiber Synapses

Synpr is a marker for mossy fiber synapses in the hippocampus, where it co-localizes with presynaptic markers like vesicular glutamate transporter 1 (VGluT1) and postsynaptic proteins such as Nectin-3 and GluK5 . Studies using synaptosomal preparations and immunolabeling have demonstrated:

  • Enrichment in Mossy Fiber Synaptosomes: Synpr is co-enriched with synapsin-3 and GluK5 in mossy fiber terminals, confirming its role in glutamatergic transmission .

  • Hippocampal Distribution: Beyond mossy fibers, Synpr is expressed in CA3 pyramidal cells and interneurons, suggesting broader roles in synaptic communication .

Neurodegenerative Diseases

In Alzheimer’s disease models, tau P301S mutations reduce Synpr levels at mossy fiber terminals, correlating with synaptic deficits. Genetic reduction of synaptogyrin-3 (a Synpr-associated protein) rescues these defects, highlighting Synpr’s involvement in synaptic pathology .

Detection and Validation Methods

Recombinant Synpr is detected using antibodies targeting epitopes spanning residues 31–130 or 250–263. Below is a comparison of validated antibodies and their applications:

Antibody SourceApplicationsReactivityObserved MW
Boster Bio (A11201-2)WB, IHC, Flow CytometryHuman, Mouse, Rat37 kDa
Bioss (bs-11367R)WB, ELISA, IHC, IFRat; Predicted: Human, MouseN/A
Abcam (ab175224)WB, Flow Cytometry (Intra)Human, Mouse, Rat29 kDa
Synaptic Systems (102 008)WB, IHC, IPMouse, RatN/A
Proteintech (14143-1-AP)WB, IP, IHC, ELISAHuman, Mouse, Rat37 kDa

Key Validation Data:

  • Western Blot: Detects a ~37 kDa band in brain lysates, consistent with post-translational modifications .

  • Immunohistochemistry: Labels perisomatic regions in CA3 pyramidal cells and interneurons .

  • Flow Cytometry: Intracellular staining confirms localization in synaptic vesicles .

Clinical and Therapeutic Relevance

Synpr’s dysregulation is implicated in neurodegenerative disorders:

  • Alzheimer’s Disease: Reduced Synpr levels correlate with mossy fiber synaptic loss and cognitive deficits .

  • Parkinson’s Disease: While not directly linked to Synpr, its interaction with synaptogyrin-3 (a regulator of dopamine uptake) suggests indirect roles in dopaminergic dysfunction .

Therapeutic Potential: Modulating Synpr or its interactors (e.g., synaptogyrin-3) may restore synaptic function in neurodegenerative diseases. Recombinant Synpr could serve as a tool for drug screening or synaptic vesicle trafficking studies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Synpr; Synaptoporin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Synpr
Target Protein Sequence
MCMVIFAPLFAMFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLQQVTFEVPT CEGKEQQKLALVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV TVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAVHSPVMSSLNTSV VFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGRYNQESYGSSGGYSQ QANLGPTSDEFGQQPSGPTSFNNQI
Uniprot No.

Target Background

Function
Synaptoporin (Synpr) is an intrinsic membrane protein of small synaptic vesicles. It is believed to be a vesicular channel protein.
Database Links
Protein Families
Synaptophysin/synaptobrevin family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.

Q&A

What is Synaptoporin and how does it relate to Synaptophysin?

Synaptoporin, also known as synaptophysin 2 and p38-2, is a synaptic vesicle protein highly homologous to synaptophysin 1 but encoded by a different gene. Like synaptophysin 1, synaptoporin contains four transmembrane regions and a short cytoplasmic tail. The key distinction is that unlike synaptophysin 1, synaptoporin is not glycosylated, which affects its biochemical properties and potentially its function. Synaptoporin belongs to the broader family of synaptophysin proteins that play critical roles in synaptic vesicle trafficking and neurotransmission .

Where is Synaptoporin predominantly expressed in the nervous system?

The distribution pattern of synaptoporin differs significantly from that of synaptophysin 1. While synaptophysin 1 shows relatively uniform expression throughout the brain, synaptoporin exhibits a more restricted distribution. Synaptoporin is particularly enriched in mossy fiber synapses in the hippocampus, making it an excellent marker for specific subsets of synapses . This differential expression pattern suggests distinct functional roles for synaptoporin in specific neural circuits, particularly those involved in hippocampal processing and memory formation.

How does Synaptoporin expression change during neural development?

Synaptoporin expression follows a developmental timeline that appears to correlate with synapse maturation. Research indicates that protein complexes involving synaptic proteins similar to synaptoporin, such as the synaptophysin-synaptobrevin complex, are upregulated during neuronal development and notably absent in embryonic rat brain . This suggests that synaptoporin likely follows a similar developmental trajectory, with increased expression coinciding with synapse formation and maturation. Researchers should consider this temporal pattern when designing developmental studies.

What are the optimal applications for Synaptoporin antibodies in research?

Synaptoporin antibodies can be effectively utilized across multiple experimental applications. Based on validated research protocols, the following applications have demonstrated successful detection of Synaptoporin:

ApplicationRecommended DilutionValidated Tissue Samples
Western Blot (WB)1:1000-1:6000Mouse brain, human brain, mouse cerebellum, rat brain
Immunoprecipitation (IP)0.5-4.0 μg for 1.0-3.0 mg of total protein lysateMouse brain
Immunohistochemistry (IHC)1:200-1:800Mouse brain, human brain, human gliomas tissue
Immunofluorescence (IF)As per published protocolsMouse, rat neural tissues

Researchers should optimize these conditions for their specific experimental setup, as sample preparation methods may influence antibody performance .

What protocols yield the best results for Synaptoporin detection in Western blotting?

For optimal Western blot detection of Synaptoporin, researchers should consider the following protocol recommendations:

  • Sample preparation: Use fresh tissue samples, particularly from brain regions with known Synaptoporin expression such as hippocampus.

  • Protein extraction: Extract in buffer containing protease inhibitors to prevent degradation.

  • Electrophoresis conditions: Use standard SDS-PAGE separation with 10-12% gels.

  • Transfer: Transfer to PVDF or nitrocellulose membranes at 100V for 60-90 minutes.

  • Blocking: Block with 5% non-fat dry milk in TBST for 1 hour at room temperature.

  • Primary antibody: Apply anti-Synaptoporin antibody at 1:1000-1:6000 dilution overnight at 4°C.

  • Detection: Expected molecular weight is approximately 37 kDa, which differs from the calculated weight of 29 kDa due to post-translational modifications .

This protocol has been validated for detecting Synaptoporin in mouse, rat, and human brain tissue samples, with consistent and specific labeling.

What are the best practices for immunohistochemical detection of Synaptoporin?

For successful immunohistochemical detection of Synaptoporin, researchers should follow these validated practices:

  • Tissue preparation: Fix tissue in 4% paraformaldehyde; both paraffin-embedded and frozen sections can be used.

  • Antigen retrieval: Use TE buffer pH 9.0 for optimal results, though citrate buffer pH 6.0 can serve as an alternative .

  • Antibody dilution: Start with 1:200-1:800 dilution range and optimize based on tissue type and fixation method.

  • Incubation: Overnight incubation at 4°C typically yields best results.

  • Detection system: Both chromogenic (DAB) and fluorescent secondary antibodies work well.

  • Controls: Include tissue from hippocampal mossy fiber regions as positive controls due to enriched expression.

  • Counterstaining: Light hematoxylin counterstaining for chromogenic detection or DAPI for fluorescence to visualize tissue architecture.

These methodological considerations help ensure specific and reproducible Synaptoporin detection across different experimental contexts .

How does Synaptoporin interact with the synaptic vesicle machinery?

Synaptoporin, like its homolog synaptophysin, appears to play critical roles in synaptic vesicle dynamics. Based on research into related synaptic proteins, particularly the interaction between synaptophysin and synaptobrevin, we can infer that Synaptoporin likely engages in protein-protein interactions that regulate vesicle trafficking and fusion. Studies have demonstrated that synaptophysin binds to synaptobrevin, affecting its availability for SNARE complex formation essential for vesicle fusion .

Research indicates that synaptophysin acts to control synaptobrevin retrieval during endocytosis and may also play a role in clearing synaptobrevin from active zones after vesicle fusion . Given the structural homology between synaptophysin and synaptoporin, similar mechanisms may apply to synaptoporin, particularly in the specific synapses where it is preferentially expressed, such as hippocampal mossy fiber synapses. This suggests synaptoporin may have specialized functions in regulating vesicle dynamics in these particular neural circuits.

What experimental approaches are effective for studying Synaptoporin-protein interactions?

Several experimental approaches have proven effective for investigating protein interactions involving Synaptoporin:

  • Immunoprecipitation (IP): This technique has been validated for Synaptoporin using 0.5-4.0 μg antibody for 1.0-3.0 mg of total protein lysate . The protocol involves:

    • Incubation of antibody with protein lysate for 16-18 hours

    • Separation using G-Sepharose suspension

    • Analysis by SDS-PAGE and Western blotting

  • Cross-linking experiments: Similar to those performed with synaptophysin, chemical cross-linkers like disuccinimidyl suberate (DSS) can be used to stabilize protein-protein interactions:

    • Prepare synaptosomes in appropriate buffer

    • Add DSS (0.5 mM final concentration)

    • Incubate at room temperature with shaking

    • Quench with Tris-HCl

    • Analyze by SDS-PAGE and immunoblotting

  • Recombinant protein binding assays: Using immobilized recombinant Synaptoporin to pull down interaction partners:

    • Express His-tagged Synaptoporin

    • Immobilize on Ni-beads

    • Incubate with brain lysate or purified candidate proteins

    • Analyze binding by Western blotting

These methodologies provide complementary approaches to investigate the interaction network of Synaptoporin and its functional implications.

How can genetic manipulation approaches be used to study Synaptoporin function?

Genetic manipulation offers powerful tools for investigating Synaptoporin function in neuronal systems:

  • Knockout/knockdown approaches:

    • siRNA or shRNA targeting Synaptoporin in neuronal cultures

    • CRISPR-Cas9 gene editing to create knockout models

    • Analysis of synaptic vesicle dynamics in the absence of Synaptoporin

  • Overexpression studies:

    • Transfection with Synaptoporin expression vectors

    • Creation of synaptoporin-fluorescent protein fusion constructs

    • Assessment of effects on synaptic transmission and plasticity

  • Mutation analysis:

    • Introduction of point mutations in key domains

    • Analysis of transmembrane regions versus cytoplasmic tail functions

    • Chimeric constructs exchanging domains with synaptophysin

These approaches can be integrated with functional readouts such as electrophysiology, optical imaging of synaptic vesicle dynamics, and behavioral assays in animal models to provide comprehensive understanding of Synaptoporin's functional significance.

How should researchers validate the specificity of anti-Synaptoporin antibodies?

Antibody validation is crucial for reliable Synaptoporin research. Recommended validation approaches include:

  • Multi-method confirmation: Verify Synaptoporin detection across different techniques (WB, IHC, IF) using the same antibody.

  • Positive and negative controls:

    • Positive controls: Hippocampal tissue (especially mossy fiber regions) known to express Synaptoporin

    • Negative controls: Tissues or cell types with minimal Synaptoporin expression

    • Blocking peptide competition: Pre-incubation with the immunizing peptide should eliminate specific signal

  • Cross-reactivity assessment: Test against recombinant synaptophysin 1 to ensure specificity, given their homology.

  • Knockout/knockdown validation: Compare staining patterns in wild-type versus Synaptoporin-depleted samples.

  • Multiple antibody concordance: Compare staining patterns using antibodies targeting different epitopes of Synaptoporin.

Researchers should refer to established criteria for antibody validation in neuroscience to ensure reproducible results .

What are common pitfalls in Synaptoporin research and how can they be avoided?

Several methodological challenges can affect Synaptoporin research:

  • Cross-reactivity with synaptophysin 1: Due to structural homology, antibodies may cross-react. Solution: Validate antibody specificity against recombinant proteins and use antibodies targeting unique regions of Synaptoporin.

  • Variable expression levels: Synaptoporin's restricted expression pattern can lead to inconsistent detection. Solution: Carefully select appropriate brain regions (particularly hippocampal mossy fibers) for analysis.

  • Post-translational modifications: The observed molecular weight (37 kDa) differs from calculated (29 kDa), suggesting modifications that may affect detection. Solution: Use appropriate positive controls and consider multiple detection methods.

  • Developmental timing: Synaptoporin expression changes during development, similar to synaptophysin-synaptobrevin complexes. Solution: Consider age-appropriate controls and document developmental stage precisely.

  • Technical challenges in membrane protein studies: As a transmembrane protein, Synaptoporin can aggregate during sample preparation. Solution: Optimize detergent conditions and sample handling to maintain protein solubility.

Awareness of these potential pitfalls can help researchers design more robust experiments and interpret results appropriately.

How can researchers optimize immunoprecipitation protocols for Synaptoporin?

Optimizing immunoprecipitation (IP) of Synaptoporin requires attention to several key factors:

  • Lysis buffer composition:

    • Include appropriate detergents (e.g., 1% Triton X-100 or CHAPS) to solubilize membrane proteins

    • Add protease inhibitors to prevent degradation

    • Consider phosphatase inhibitors if studying phosphorylation states

  • Antibody selection and amounts:

    • Use 0.5-4.0 μg antibody for 1.0-3.0 mg of total protein lysate

    • Longer incubation periods (16-18 hours) at 4°C improve yield

  • Bead selection:

    • G-Sepharose beads work well with most antibodies

    • Pre-clear lysates to reduce non-specific binding

  • Washing conditions:

    • Multiple washes in extraction buffer to reduce background

    • Balance between stringency and maintaining specific interactions

  • Elution and analysis:

    • SDS-PAGE under non-denaturing conditions may preserve protein interactions

    • Consider native PAGE for intact complexes

Researchers should titrate conditions based on their specific experimental system to achieve optimal results .

How should changes in Synaptoporin expression be interpreted in neurological disease models?

Interpreting alterations in Synaptoporin expression in disease contexts requires careful consideration of several factors:

  • Region-specific analysis: Given Synaptoporin's differential expression pattern, changes should be interpreted in the context of specific brain regions, particularly hippocampal mossy fiber synapses.

  • Comparison with synaptophysin 1: Changes in Synaptoporin-to-synaptophysin ratio may be more informative than absolute Synaptoporin levels, as they may indicate shifts in synaptic composition rather than generalized synapse loss.

  • Correlation with functional outcomes: Relate Synaptoporin changes to electrophysiological or behavioral alterations to establish functional significance.

  • Developmental considerations: Distinguish between disease-related changes and developmental variations, especially when studying developmental disorders.

  • Cell-type specificity: Consider whether alterations occur in specific neuronal populations, which may be masked in whole-tissue analyses.

These interpretative frameworks help distinguish between causative changes, compensatory mechanisms, and epiphenomena in disease models.

What are the current hypotheses regarding Synaptoporin's role in synaptic plasticity?

Based on its homology to synaptophysin and its enriched expression in hippocampal mossy fiber synapses, several hypotheses about Synaptoporin's role in synaptic plasticity have emerged:

  • Vesicle cycling regulation: Similar to synaptophysin's role in synaptobrevin trafficking, Synaptoporin may regulate the availability of SNARE proteins at mossy fiber synapses, potentially influencing forms of plasticity specific to these synapses .

  • Specialized vesicle pool management: The restricted expression of Synaptoporin suggests it may regulate specialized aspects of vesicle pools in specific synapse types.

  • Activity-dependent regulation: Studies of related proteins suggest Synaptoporin may participate in activity-dependent regulation of synaptic strength, particularly in circuits showing robust plasticity like hippocampal mossy fibers.

  • Developmental synapse refinement: The upregulation of related protein complexes during development suggests Synaptoporin may contribute to synapse maturation and refinement .

Future research combining conditional genetic manipulation with electrophysiological and imaging approaches will be essential to test these hypotheses.

How does Synaptoporin interact with other synaptic vesicle proteins to regulate neurotransmission?

Understanding Synaptoporin's interaction network is crucial for deciphering its functional role:

  • SNARE protein interactions: By analogy with synaptophysin, Synaptoporin likely interacts with synaptobrevin/VAMP family proteins, potentially regulating their availability for SNARE complex formation .

  • Vesicle trafficking machinery: Interactions with endocytic proteins may facilitate the retrieval of synaptic vesicle components following exocytosis.

  • Active zone clearance: Synaptoporin may participate in the clearance of fusion machinery components from active zones after vesicle fusion, similar to the role proposed for synaptophysin .

  • Calcium sensor interactions: Potential coordination with calcium-sensing proteins could provide activity-dependent regulation of vesicle availability.

  • Cytoskeletal interactions: Connections to the cytoskeleton may influence vesicle mobilization and positioning relative to release sites.

These interactions likely form the molecular basis for Synaptoporin's contribution to synaptic function, particularly in the specialized synapses where it is enriched.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.