Recombinant Mouse Synaptotagmin-3 (Syt3)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Properties

Recombinant Syt3 is produced in systems like HEK293T cells or bacterial vectors, often with affinity tags (e.g., C-Myc/DDK) for purification . Key biochemical traits include:

PropertyDetailsSource
Expression HostsHEK293T cells, bacterial systems (e.g., E. coli)
TagsC-Myc/DDK (human recombinant), proprietary tags for mouse variants
Storage BufferTris-based buffer with 50% glycerol (pH 7.3)
Stability-20°C to -80°C (long-term); 4°C for short-term aliquots

Presynaptic Roles

Syt3 acts as a high-affinity Ca²⁺ sensor (Kd ~1–5 µM), accelerating vesicle replenishment during sustained neuronal activity. Key findings include:

  • Vesicle Replenishment: Syt3 knockout (KO) mice exhibit enhanced short-term depression and slower recovery from synaptic depression, rescued by Ca²⁺ chelators like EGTA-AM .

  • Facilitation: Promotes short-term facilitation under low release probability, enhancing synaptic output .

  • Vesicle Docking: Modulates the transition of loosely docked vesicles to tightly docked states, increasing the readily releasable pool (RRP) .

Postsynaptic Roles

Syt3 drives AMPA receptor internalization, contributing to long-term depression (LTD) and synaptic weakening. In Syt3 KO mice, spatial memory tasks reveal impaired forgetting and relearning deficits .

Electrophysiology Studies

Experimental ModelObservationSource
Calyx of Held (WT vs. KO)KO synapses show 2× slower recovery from depression (τ ~2 s vs. 1 s)
Cerebellar Climbing FibersKO synapses exhibit greater depression and reduced RRP size
Mossy Fiber SynapsesKO synapses show ~3× slower recovery post-depression

Rescue Experiments

Presynaptic Syt3 expression via AAV vectors in KO mice restores normal synaptic transmission and Ca²⁺-dependent recovery, confirming its cell-autonomous role .

Clinical and Therapeutic Relevance

  • Memory and Forgetting: Syt3-mediated AMPA receptor internalization is implicated in synaptic plasticity and memory consolidation .

  • Neurodegenerative Diseases: Dysregulation of Syt3 may contribute to synaptic dysfunction in Alzheimer’s or Parkinson’s disease .

  • Diabetes: Syt3 facilitates insulin secretion in pancreatic β-cells, suggesting therapeutic potential in diabetes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
Syt3; Synaptotagmin-3; Synaptotagmin III; SytIII
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Syt3
Target Protein Sequence
MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRGGGSGEAGAPCGRISFALRYLYGSDHLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE
Uniprot No.

Target Background

Function
Synaptotagmin-3 (Syt3) is a calcium (Ca2+) sensor involved in Ca2+-dependent exocytosis of secretory vesicles. This function is mediated by Ca2+ and phospholipid binding to its C2 domain. Ca2+ binding induces the C2 domains to bind to phospholipid membranes and assembled SNARE complexes, both actions contributing to the initiation of exocytosis. Syt3 also plays a role in dendrite formation by melanocytes.
Database Links

KEGG: mmu:20981

STRING: 10090.ENSMUSP00000112432

UniGene: Mm.4824

Protein Families
Synaptotagmin family
Subcellular Location
Cell membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Single-pass membrane protein.

Q&A

What is the expression pattern of Synaptotagmin-3 in mouse tissues?

Synaptotagmin-3 shows a distinct expression pattern across mouse tissues. It is broadly expressed throughout the brain but is particularly enriched in the brainstem, cerebellum, and hippocampus . Immunolabeling studies have demonstrated strong Syt3 presence in the medial nucleus of the trapezoid body (MNTB) in the brainstem, specifically in the region of calyx of Held nerve terminals, where it overlaps with the presynaptic marker VGLUT1 . In the cerebellum, Syt3 is abundant in the molecular layer, where it colocalizes with VGLUT1 and VGLUT2, which mark cerebellar parallel fibers and climbing fibers respectively .

Beyond the central nervous system, Syt3 has been detected in pancreatic tissue. In pancreatic acinar cells, Syt3 localizes to microsomal fractions and partially colocalizes with the endolysosomal marker LAMP-1 . Syt3 is also present in pancreatic islet β-cells, where it appears to function as a high-affinity Ca²⁺ sensor for exocytosis .

Biochemical fractionation studies have revealed that Syt3 is present in both presynaptic and postsynaptic compartments in neuronal tissue , suggesting diverse functional roles across different cellular locations.

What structural features distinguish Synaptotagmin-3 from other synaptotagmin isoforms?

Synaptotagmin-3 belongs to the synaptotagmin family of calcium-sensing proteins but possesses several distinct structural characteristics:

Syt3 has a molecular weight of approximately 63 kDa as determined by immunoblotting, which aligns with its predicted molecular mass . Like other synaptotagmins, Syt3 contains C2 domains that bind Ca²⁺ and phospholipids, but its calcium-binding properties differ significantly from those of Synaptotagmin-1 (Syt1).

While Syt1 functions as a low-affinity Ca²⁺ sensor in neuronal transmission, Syt3 is believed to serve as a high-affinity Ca²⁺ sensor, particularly in neuroendocrine cells such as pancreatic islet β-cells . This functional difference reflects distinct structural properties of their C2 domains.

The C2 domains of Syt3 are functionally critical, as demonstrated by experiments showing that introduction of the Syt1 C2AB domain into permeabilized acini inhibited Ca²⁺-dependent exocytosis by 35%, while constructs of Syt3 had no effect . This suggests that despite structural similarity in the C2 domain architecture across synaptotagmin isoforms, there are significant functional differences that likely arise from subtle variations in these domains.

Calcium binding to Syt3 is essential for its function, as demonstrated by studies using Ca²⁺-binding deficient mutants (Syt3 D/N), which fail to rescue the phenotypes observed in Syt3 knockout models .

How should researchers validate antibodies for Synaptotagmin-3 detection?

Proper validation of antibodies is crucial for reliable detection of Synaptotagmin-3. Researchers should implement the following validation strategies:

Knockout Control Testing:
A critical validation step is testing antibodies on tissues from Syt3 knockout animals. Immunolabeling studies have confirmed antibody specificity by demonstrating strong labeling in wildtype mice and complete absence of signal in Syt3 knockout tissue . This approach provides definitive confirmation of antibody specificity.

Antigen Competition Assays:
For polyclonal antibodies, preincubation with the specific peptide antigen should eliminate immunoreactivity. Researchers have successfully validated Syt3 antibodies by preincubating with a 10-fold molar excess of peptide antigen for 2 hours at 4°C prior to tissue incubation . The absence of signal following peptide competition confirms antibody specificity.

Western Blot Molecular Weight Verification:
Immunoblotting should detect a band at approximately 63 kDa in brain lysates and membrane fractions . The molecular weight should be consistent across different tissue samples and match the predicted mass of Syt3.

Subcellular Fractionation Profile:
In biochemical fractionation experiments, authentic Syt3 antibodies should detect the protein in microsomal fractions with enhanced signal following NaCO₃ (pH 11) washing . In neuronal tissues, Syt3 should be detected in both presynaptic and postsynaptic enriched fractions .

Colocalization with Known Markers:
For immunofluorescence applications, validated Syt3 antibodies should show expected colocalization patterns with established markers. In neurons, Syt3 partially colocalizes with presynaptic markers like VGLUT1, while in pancreatic acinar cells, it partially colocalizes with LAMP-1 .

What expression systems are most effective for producing recombinant Synaptotagmin-3?

Production of recombinant Synaptotagmin-3 for research applications can be accomplished using several expression systems, each with specific advantages depending on the experimental requirements:

Viral Vector Expression In Vivo:
Adeno-associated viral (AAV) vectors have been successfully used to express Syt3 in vivo. Researchers have employed bicistronic AAV constructs that co-express Syt3 and GFP, allowing visual identification of transduced cells . This approach is particularly valuable for rescue experiments in Syt3 knockout animals, where selective re-expression can confirm phenotype specificity. When injected into the ventral cochlear nucleus, these vectors effectively restore Syt3 expression in calyx of Held nerve terminals after 4-5 weeks .

Mammalian Cell Expression:
For full-length Syt3 with proper post-translational modifications, mammalian expression systems such as HEK293 or CHO cells are recommended. These systems ensure appropriate protein folding and modifications that may be critical for Syt3 function.

Bacterial Expression Systems:
For studies focusing on specific domains (particularly the C2 domains), bacterial expression in E. coli provides high protein yields. This approach has been used successfully to produce the C2AB domains for functional studies .

Domain-Specific Constructs:
When investigating specific aspects of Syt3 function, expressing individual domains can be informative. The C2AB domain has been used in competition experiments to investigate the role of these domains in Ca²⁺-dependent processes .

Mutant Variants:
To explore structure-function relationships, expression of mutant variants is valuable. Ca²⁺-binding deficient mutants (Syt3 D/N) have been expressed to determine whether Ca²⁺ binding is required for function . These constructs typically involve targeted mutations of aspartate residues in the C2 domains that coordinate Ca²⁺ binding.

Expression SystemAdvantagesBest Applications
AAV VectorsIn vivo expression, cell-type specific targetingRescue experiments, in vivo studies
Mammalian CellsProper post-translational modificationsFull-length protein studies, interaction assays
E. coliHigh yield, cost-effectiveDomain-specific studies, structural analyses

What purification strategies yield highest quality Synaptotagmin-3 protein?

Obtaining high-quality recombinant Synaptotagmin-3 requires careful consideration of purification strategies to maintain protein integrity and functionality:

Affinity Tag Selection:
His-tagged constructs allow purification using nickel or cobalt affinity chromatography, while GST-fusion proteins can be purified using glutathione-based methods. For Syt3, His-tagging at the N-terminus is often preferred to minimize interference with C2 domain function at the C-terminus.

Membrane Protein Considerations:
As Syt3 is a membrane-associated protein, purification buffers should contain detergents at concentrations above their critical micelle concentration (CMC) to maintain protein solubility. Commonly used detergents include CHAPS, n-dodecyl-β-D-maltoside (DDM), or octyl glucoside.

Calcium Chelation During Purification:
Since Syt3 is calcium-sensitive, purification should be performed either in the presence of calcium chelators (EGTA or EDTA) to obtain the calcium-free form, or with defined Ca²⁺ concentrations to study calcium-bound states. This approach prevents uncontrolled calcium-dependent conformational changes during purification.

Size Exclusion Chromatography:
Following initial affinity purification, size exclusion chromatography is recommended to remove aggregates and ensure monodispersity of the purified protein. This step is particularly important for structural and functional studies requiring homogeneous protein samples.

Protecting C2 Domain Integrity:
The C2 domains are crucial for Syt3 function . Purification conditions should be optimized to maintain their structural integrity, including the use of protease inhibitors and avoidance of harsh elution conditions that might denature these domains.

Quality Control Assessments:
Circular dichroism spectroscopy can verify proper folding of the purified protein. Functional assays, such as calcium-dependent phospholipid binding, should be performed to confirm that the purified protein retains expected activities.

How does Synaptotagmin-3 facilitate vesicle replenishment at synapses?

Synaptotagmin-3 plays a critical role in maintaining reliable synaptic transmission during sustained neuronal activity through its function in vesicle replenishment. Research has revealed several key mechanisms:

Calcium-Dependent Recovery Regulation:
Syt3 mediates calcium-dependent recovery (CDR) from synaptic depression. In Syt3 knockout mice, recovery from depression after high-frequency stimulation is significantly slower and insensitive to presynaptic residual Ca²⁺ . At cerebellar climbing fibers, Syt3 knockouts exhibited approximately 2-fold slower recovery compared to wild-type synapses . This effect is calcium-dependent, as application of the calcium chelator EGTA-AM slowed recovery in wild-type animals to match that observed in Syt3 knockouts .

Readily Releasable Pool Maintenance:
During sustained neuronal firing, Syt3 speeds vesicle replenishment and increases the size of the readily releasable pool (RRP) of vesicles . Multiple independent methods for estimating RRP size have confirmed that the RRP is significantly increased in wild-type synapses compared to Syt3 knockout synapses . These methods included back-extrapolation of cumulative release (corrected for early replenishment), forward-extrapolation methods, and exponential fitting of initial depression .

Vesicle Docking Facilitation:
Mathematical modeling of vesicle trafficking suggests that Syt3 combats synaptic depression by accelerating vesicle docking at active zones . The most robust model indicates that Syt3 increases the transition rate from loosely to tightly docked states, rather than modulating the release probability of already-docked vesicles . This model is supported by evidence for activity-dependent, transient docking of vesicles .

Calcium-Binding Requirement:
The calcium-binding capability of Syt3 is essential for its function in vesicle replenishment. Expression of a calcium-binding deficient mutant (Syt3 D/N) fails to rescue the enhanced depression and slowed recovery phenotypes observed in Syt3 knockout animals . This indicates that Syt3 acts as a calcium sensor that translates elevations in residual calcium during high-frequency activity into accelerated vesicle replenishment.

Multiple Synapse Conservation:
Syt3's role in facilitating vesicle replenishment is conserved across multiple synapse types, including the calyx of Held, cerebellar climbing fibers, and cerebellar mossy fiber-to-granule cell synapses . This conservation suggests a fundamental mechanism for maintaining neurotransmission during periods of high activity throughout the nervous system.

What experimental evidence demonstrates Synaptotagmin-3's role in AMPA receptor trafficking?

Synaptotagmin-3's involvement in AMPA receptor trafficking is supported by compelling experimental evidence, particularly in the context of ischemia/reperfusion (I/R) injury:

Direct Syt3-GluA2 Interaction:
Biochemical studies have demonstrated that Syt3 physically interacts with the GluA2 subunit of AMPA receptors . This interaction is significantly enhanced following ischemia/reperfusion injury, suggesting a regulated molecular mechanism rather than a constitutive interaction .

Surface Expression Regulation:
Experimental evidence shows that Syt3 affects synaptic plasticity by regulating post-synaptic receptor endocytosis . Enhanced Syt3-GluA2 interactions correlate with decreased GluA2 surface expression, supporting a model where Syt3 promotes internalization of GluA2-containing AMPA receptors .

CP-AMPAR Formation:
The decreased surface expression of GluA2 subunits resulting from Syt3-GluA2 interactions promotes the formation of calcium-permeable AMPA receptors (CP-AMPARs) . This has been verified through electrophysiological measurements of AMPAR currents showing properties consistent with GluA2-lacking channels, such as increased inward rectification and calcium permeability .

Knockdown and Overexpression Studies:
Genetic manipulation of Syt3 levels provides strong evidence for its role in receptor trafficking:

  • Knockdown of Syt3 protects against I/R injury, promotes recovery of motor function, and inhibits cognitive decline

  • Conversely, overexpression of Syt3 exacerbates I/R injury and associated functional deficits

Therapeutic Intervention Efficacy:
Further supporting Syt3's role in AMPAR trafficking, therapeutic approaches targeting this pathway have demonstrated efficacy:

  • CP-AMPAR antagonists block the detrimental effects associated with Syt3 upregulation

  • TAT-GluA2-3Y peptide, which disrupts the Syt3-GluA2 interaction, promotes recovery from neurological impairments and improves cognitive function following I/R injury

These findings collectively establish that Syt3 regulates AMPA receptor trafficking through direct interaction with the GluA2 subunit, with significant implications for synaptic function in both physiological and pathological conditions.

Investigating the calcium-binding properties of Synaptotagmin-3 requires sophisticated methodological approaches that span structural, biophysical, and functional techniques:

Mutational Analysis Combined with Functional Assays:
A powerful approach involves generating calcium-binding deficient mutants (e.g., Syt3 D/N) where aspartate residues in the C2 domains that coordinate calcium are replaced with asparagine . When expressed in Syt3 knockout backgrounds, these mutants fail to rescue phenotypes such as enhanced depression and slowed recovery, confirming the functional importance of calcium binding . This approach connects structural elements directly to physiological function.

Calcium-Dependent Phospholipid Binding Assays:
Since synaptotagmins bind phospholipids in a calcium-dependent manner, membrane binding assays provide valuable insights into calcium sensitivity:

  • Liposome Co-sedimentation: Purified Syt3 protein is incubated with liposomes containing acidic phospholipids in the presence of varying calcium concentrations. After centrifugation, the protein bound to liposomes pellets, allowing quantification of binding as a function of calcium concentration.

  • FRET-Based Assays: Fluorescently labeled Syt3 and liposomes containing FRET acceptor lipids can detect calcium-dependent membrane interactions with high temporal resolution.

Electrophysiological Manipulation of Calcium:
Electrophysiological recordings provide functional readouts of Syt3 activity under controlled calcium conditions:

  • Varying Extracellular Calcium: Recordings in different extracellular calcium concentrations can establish the calcium-sensitivity of Syt3-dependent processes such as recovery from depression .

  • Calcium Chelator Application: Experiments using EGTA-AM to reduce residual calcium have demonstrated that Syt3-mediated recovery from depression is calcium-dependent in wild-type synapses but calcium-insensitive in Syt3 knockout synapses .

Structural Studies of Calcium-Binding Domains:
Direct structural analysis of the C2 domains provides mechanistic insights:

  • X-ray Crystallography: Structures of Syt3 C2 domains with and without bound calcium reveal conformational changes upon calcium binding.

  • NMR Titration Experiments: Allow determination of calcium-binding affinities for individual binding sites within the C2 domains and detection of subtle conformational changes.

Comparative Analysis with Other Synaptotagmins:
Contrasting Syt3's properties with well-characterized isoforms like Syt1 provides valuable context:

  • While Syt1 functions as a low-affinity calcium sensor, Syt3 may serve as a high-affinity calcium sensor in certain contexts such as pancreatic islet β-cells .

  • Direct comparison of calcium-binding affinities and kinetics between Syt1 and Syt3 can highlight functional specializations.

How do Synaptotagmin-3 knockout phenotypes reveal its function in synaptic transmission?

Synaptotagmin-3 knockout models have provided crucial insights into its physiological functions, particularly in synaptic transmission. The phenotypic analysis of these models reveals several key aspects of Syt3 function:

Enhanced Short-Term Depression:
Syt3 knockout mice exhibit enhanced short-term depression during high-frequency stimulation at multiple synapses including the calyx of Held, cerebellar climbing fibers, and mossy fiber-to-granule cell synapses . This phenotype is particularly evident at higher stimulation frequencies (200-300 Hz) , suggesting that Syt3 is specifically important for maintaining synaptic efficacy during periods of intense activity.

Impaired Recovery from Depression:
A defining characteristic of Syt3 knockout synapses is significantly slower recovery from synaptic depression compared to wildtype:

  • At the calyx of Held, the weighted time constant for recovery (τW) is approximately 4 seconds in Syt3 knockouts compared to 1.4 seconds in wildtype mice .

  • At cerebellar climbing fibers, recovery is approximately 2-fold slower in Syt3 knockouts .

  • Similar deficits in recovery are observed at cerebellar mossy fiber-to-granule cell synapses .

These consistent findings across diverse synapse types indicate a conserved role for Syt3 in facilitating rapid recovery from synaptic depression.

Loss of Calcium-Dependent Recovery:
In wildtype mice, recovery from depression is accelerated by residual calcium and slowed by application of the calcium chelator EGTA-AM. In striking contrast, recovery in Syt3 knockouts is insensitive to residual calcium, and EGTA-AM has no effect on recovery . This phenotype definitively establishes Syt3 as a mediator of calcium-dependent recovery from synaptic depression.

Reduced Readily Releasable Pool Size:
Syt3 knockout synapses have a significantly smaller readily releasable pool (RRP) of vesicles compared to wildtype synapses . This reduction has been confirmed using multiple independent analytical methods, including back-extrapolation of cumulative release, forward-extrapolation methods, and exponential fitting of initial depression . This phenotype suggests that Syt3 contributes to maintaining the size of the RRP during periods of sustained activity.

Normal Basal Synaptic Properties:
Despite these deficits in high-frequency transmission and recovery, several basal synaptic properties appear normal in Syt3 knockouts:

  • Spontaneous EPSC amplitudes and frequencies are similar in wildtype and Syt3 knockout animals, indicating normal postsynaptic receptor density and initial release probability .

  • EPSCs evoked by single stimuli have similar amplitudes and kinetics in wildtype and Syt3 knockout mice .

This selective impairment in activity-dependent functions, with preservation of basal properties, highlights Syt3's specialized role in sustaining synaptic transmission during high-frequency activity.

What role does Synaptotagmin-3 play in brain injury following ischemia/reperfusion?

Synaptotagmin-3 plays a significant role in neuronal damage following ischemia/reperfusion (I/R) injury through several interconnected mechanisms:

Upregulation in Vulnerable Tissue:
Studies have demonstrated that Syt3 is upregulated in the penumbra (the potentially salvageable tissue surrounding the core of the infarct) after ischemia/reperfusion injury . This upregulation appears to be part of the pathophysiological response that contributes to secondary damage processes rather than a protective mechanism.

Enhanced GluA2 Interaction and Internalization:
I/R injury significantly augments interactions between Syt3 and the GluA2 subunit of AMPA receptors . This enhanced interaction leads to increased internalization of GluA2-containing AMPA receptors, resulting in decreased surface expression of these receptors . The process represents a pathological exaggeration of Syt3's normal role in regulating post-synaptic receptor endocytosis.

Formation of Calcium-Permeable AMPA Receptors:
The reduction in surface GluA2 promotes the formation of calcium-permeable AMPA receptors (CP-AMPARs) . Unlike GluA2-containing AMPA receptors, CP-AMPARs allow calcium influx, which can trigger excitotoxic cell death pathways in neurons already compromised by ischemic conditions. This creates a detrimental positive feedback loop where increased calcium entry further damages neurons.

Experimental Evidence from Genetic Manipulation:
The causal role of Syt3 in I/R injury pathophysiology is supported by genetic manipulation studies:

  • Knockdown of Syt3 provides significant protection against I/R injury, promotes recovery of motor function, and inhibits cognitive decline .

  • Conversely, overexpression of Syt3 exacerbates I/R injury and associated functional deficits, confirming Syt3's detrimental role in this context .

Therapeutic Targeting of the Syt3-GluA2 Pathway:
The Syt3-GluA2 interaction represents a promising therapeutic target for improving outcomes after ischemic brain injury:

  • CP-AMPAR antagonists block the detrimental effects of calcium influx through these receptors, providing neuroprotection .

  • The TAT-GluA2-3Y peptide, which specifically disrupts the Syt3-GluA2 complex, promotes recovery from neurological impairments and improves cognitive function following I/R injury .

These findings collectively establish Syt3 as a key player in the pathophysiology of ischemic brain injury, acting primarily through dysregulation of AMPA receptor trafficking and promoting formation of calcium-permeable channels that exacerbate neuronal damage.

How does Synaptotagmin-3 influence vesicle transition states during exocytosis?

Synaptotagmin-3 plays a critical role in regulating vesicle transition states during the exocytosis process, particularly in facilitating vesicle docking and replenishment:

Regulation of Loose-to-Tight Docking Transitions:
Mathematical modeling of synaptic vesicle trafficking, constrained by experimental data from wild-type and Syt3 knockout synapses, indicates that Syt3's primary function is to increase the transition rate from loosely to tightly docked vesicle states . Models in which Syt3 simply modulated the release probability of already-docked vesicles failed to reproduce the behavior of wild-type synapses, while models where Syt3 accelerated docking transitions provided excellent fits to experimental data .

Vesicle State Diagram:
Based on the research findings, we can construct a model of vesicle states influenced by Syt3:

Reserve PoolLoosely DockedSyt3 + Ca2+Tightly DockedFusion\text{Reserve Pool} \rightarrow \text{Loosely Docked} \xrightarrow{\text{Syt3 + Ca}^{2+}} \text{Tightly Docked} \rightarrow \text{Fusion}

In this model, vesicles are first recruited to a loosely docked state from a reserve pool. In the presence of Syt3 and calcium, these loosely docked vesicles more rapidly transition to a tightly docked state, from which they can undergo fusion .

Readily Releasable Pool Expansion:
By facilitating the transition of vesicles to the tightly docked state, Syt3 effectively increases the size of the readily releasable pool (RRP) of vesicles . Multiple analytical methods have confirmed that the RRP is significantly larger in wild-type synapses compared to Syt3 knockout synapses . This expansion of the RRP is crucial for maintaining neurotransmission during periods of high-frequency activity.

Calcium-Dependent Mechanism:
The ability of Syt3 to facilitate vesicle state transitions is calcium-dependent. Calcium binding to Syt3's C2 domains is required for this function, as demonstrated by the failure of calcium-binding deficient mutants (Syt3 D/N) to rescue the phenotypes observed in Syt3 knockout models . This calcium-dependency allows Syt3 to couple residual presynaptic calcium during high-frequency activity to accelerated vesicle replenishment.

Activity-Dependent, Transient Docking:
The model of Syt3 function is supported by recent evidence for activity-dependent, transient docking of vesicles . This suggests that during periods of high activity, elevated calcium levels activate Syt3, which then promotes the stabilization of loosely docked vesicles into a tightly docked, release-ready state. This mechanism allows for rapid replenishment of the readily releasable pool during ongoing activity.

What experimental approaches can determine Synaptotagmin-3's endolysosomal functions?

Investigating Synaptotagmin-3's endolysosomal functions requires specialized experimental approaches that can distinguish this role from its other cellular functions:

Subcellular Colocalization Analysis:
Advanced imaging approaches can precisely define Syt3's association with endolysosomal compartments:

  • Triple-Label Confocal Microscopy: Simultaneous labeling of Syt3 with established markers of early endosomes (EEA1), late endosomes (Rab7), and lysosomes (LAMP-1) can map Syt3's distribution across the endolysosomal system. This approach has already demonstrated significant colocalization between Syt3 and LAMP-1 in pancreatic acinar cells .

  • Super-Resolution Microscopy: Techniques such as STORM or PALM provide nanoscale resolution that can determine whether Syt3 is directly incorporated into endolysosomal membranes or merely associated with these compartments.

  • Live-Cell Imaging: Using fluorescently tagged Syt3 combined with labeled endolysosomal markers allows tracking of dynamic interactions and potential cargo trafficking between compartments.

Biochemical Fractionation Methods:
Refined fractionation approaches can isolate specific endolysosomal compartments:

  • Density Gradient Separation: Sequential centrifugation steps can separate early endosomes, late endosomes, and lysosomes based on their distinct densities, allowing assessment of Syt3 distribution across these fractions.

  • Immunoisolation: Magnetic beads coated with antibodies against specific endolysosomal markers can pull down intact organelles for analysis of associated proteins including Syt3.

  • Proteomic Analysis: Mass spectrometry of immunoprecipitated Syt3 complexes can identify binding partners specific to endolysosomal trafficking pathways.

Functional Trafficking Assays:
Assays that track specific cargo through the endolysosomal system can reveal Syt3's functional role:

  • Receptor Internalization and Sorting: Tracking labeled receptors (e.g., transferrin receptor, EGFR) through endocytic and recycling pathways in cells with normal or altered Syt3 levels can reveal specific trafficking steps that require Syt3.

  • Lysosomal Enzyme Delivery: Measuring the efficiency of lysosomal enzyme sorting and delivery via the mannose-6-phosphate pathway in Syt3-deficient cells.

  • pH-Sensitive Probes: Using cargo tagged with pH-sensitive fluorophores to distinguish between early endosomes (mildly acidic) and lysosomes (strongly acidic) while tracking Syt3's involvement.

Genetic Manipulation Approaches:
Targeted disruption of Syt3 can reveal its specific endolysosomal functions:

  • Domain-Specific Mutations: Creating mutants that selectively disrupt Syt3's interaction with endolysosomal proteins while preserving other functions.

  • Cell-Type Specific Knockouts: Since Syt3 has different functions in different cell types, conditional knockout models allow isolation of its endolysosomal functions in specific cell populations where this role predominates, such as pancreatic acinar cells .

  • Rescue Experiments: Selective restoration of Syt3 to specific compartments using targeting motifs can determine which aspects of endolysosomal function require Syt3.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.