Recombinant Mouse Syntaphilin (Snph)

Shipped with Ice Packs
In Stock

Description

Function and Mechanism

Syntaphilin acts as an inhibitor of both SNARE-based fusion and dynamin-mediated endocytosis. It binds to syntaxin-1, thereby controlling the availability of free syntaxin-1 for SNARE complex assembly. This regulatory function is critical for maintaining synaptic homeostasis .

In addition to its role in synaptic vesicle regulation, syntaphilin is involved in the immobilization of axonal mitochondria. It binds to kinesin-1 (KIF5), inhibiting its motor activity and thereby preventing mitochondrial transport along axons. This mechanism is crucial for maintaining mitochondrial distribution and ensuring proper neuronal function in response to activity .

3.1. Mitochondrial Dynamics

Studies using syntaphilin knockout mice have shown that syntaphilin targets axonal mitochondria and controls their mobility by interacting with microtubules. This interaction is crucial for maintaining mitochondrial densities within axons and near synapses .

3.2. Interaction with Dynein Light Chain LC8

Dynein light chain LC8 enhances syntaphilin's interaction with microtubules, thereby regulating axonal mitochondrial mobility. This interaction is mediated by a specific LC8-binding motif on syntaphilin .

3.3. Activity-Dependent Regulation

Neuronal activity recruits syntaphilin to axonal mitochondria, leading to their immobilization. This process is mediated by a Miro-Ca²⁺ sensing switch, which controls the KIF5-SNPH coupling in response to neuronal activity .

Production and Characteristics

Recombinant human syntaphilin is typically produced in Escherichia coli as a single, non-glycosylated polypeptide chain containing 444 amino acids, with a molecular mass of approximately 48.2 kDa . While specific data on recombinant mouse syntaphilin is not readily available, it is likely to have similar characteristics.

Data Tables

Given the lack of specific data on recombinant mouse syntaphilin, the following table summarizes key features of human syntaphilin, which may provide insights into its mouse counterpart:

FeatureDescription
SourceEscherichia coli
Amino Acids444 (1-424)
Molecular MassApproximately 48.2 kDa
FunctionInhibits SNARE complex formation; regulates mitochondrial dynamics
InteractionsSyntaxin-1, KIF5, Dynein Light Chain LC8

References

  1. Abeomics: Human Syntaphilin Recombinant Protein.

  2. PMC: Kinesin-1–syntaphilin coupling mediates activity-dependent immobilization of axonal mitochondria.

  3. PMC: Structure-Activity Relationship Studies in Substituted Sulfamoyl Benzamidothiazoles.

  4. Prospec Bio: SNPH Protein Human Recombinant.

  5. JNeurosci: Dynein Light Chain LC8 Regulates Syntaphilin-Mediated Axonal Mitochondrial Mobility.

  6. PMC: In vivo analysis of compound activity and mechanism of action using epistasis in Drosophila.

  7. Wikipedia: Syntaphilin.

  8. AACR Journals: Syntaphilin Ubiquitination Regulates Mitochondrial Dynamics and Metastasis Suppression.

  9. Abcam: Recombinant Human SNPH protein.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Snph; Kiaa0374; Syntaphilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-495
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Snph
Target Protein Sequence
MAMSLQGSRRASAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSCKGSDSSPTPRRSMKYTL CSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQED WIEEECHRVEAQLALKEARKEIRQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETL LHSMEVAQNGVAKEEGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSNTSAEDG ADSGYVAADDTLSRTDALEASSLLSSGVDCGLEEASLHSSFNLGPRFPASNTYEKLLCGM EAGVQVSCMQERAIQTDFVQYQPDLNTILEKVGQAQVCGSVLKDRHSELDPHPSGPRDPD SAVVVTVGDELEAPEPITCGPATHRPAVNSNPGLPVSVVCPVEEEEEEAAAATTTEKEPK SYWSRHYIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSLLRGCCTVALHSIRRISCR SLGQPSSSTAGGSQL
Uniprot No.

Target Background

Function

Inhibits SNARE complex formation by sequestering free syntaxin-1.

Gene References Into Functions
  1. DISC1, in conjunction with SNPH, is a component of a regulatory complex controlling mitochondrial anchoring in response to neuronal activation. PMID: 27370822
  2. SNPH acts as a stress-regulated mitochondrial switch influencing the cell proliferation-motility balance in cancer, presenting a potential therapeutic target. PMID: 28891816
  3. Stress-induced mitochondrial removal from axons is facilitated by the bulk release of the mitochondrial anchoring protein syntaphilin (SNPH) via a novel pathway involving mitochondria-derived cargos, independent of Parkin, Drp1, and autophagy. PMID: 28472658
  4. SNPH deletion demonstrates significant benefits in the Shiverer mouse model, including increased survival, reduced cerebellar damage, suppressed oxidative stress, and improved mitochondrial health. PMID: 25834054
  5. Syntaphilin expression in optic nerve astrocytes may be implicated in axonal injury. PMID: 25447562
  6. SNPH is essential for activity-dependent regulation of mitochondrial transport. PMID: 23857772
  7. Syntaphilin (SNPH) plays a role in mitochondrial docking via its interaction with microtubules. Axonal mitochondria expressing SNPH (endogenously or exogenously) exhibit reduced mobility. PMID: 18191227
  8. Our research suggests a novel role for LC8 and provides mechanistic insights into how SNPH and LC8 immobilize mitochondria through a dynamic interaction between the docking receptor and the axonal cytoskeleton. PMID: 19641106
Database Links

KEGG: mmu:241727

UniGene: Mm.39312

Subcellular Location
Membrane; Single-pass membrane protein. Cell junction, synapse, synaptosome.

Q&A

What is Syntaphilin and what is its primary function in neurons?

Syntaphilin (Snph) is a neuron-specific protein that functions as a docking receptor for axonal mitochondria through its interaction with microtubules. In mature neurons, approximately one-third of axonal mitochondria are mobile at instantaneous velocities of 0–2.0 μm/sec, while a large proportion remains stationary. This stationary population is maintained by Snph, which anchors mitochondria to the microtubule-based cytoskeleton. Proper distribution of mitochondria within axons and at synapses is critical for neuronal function, as these organelles provide local energy and calcium buffering required for various neuronal processes. Snph was initially identified as a candidate inhibitor of presynaptic function, but subsequent research revealed its essential role in mitochondrial positioning .

How is the expression of Snph developmentally regulated in mouse neurons?

The expression of Snph in wild-type mouse brain follows a strict developmental timeline. According to studies, Snph expression is relatively low at postnatal day 7 and peaks approximately two weeks after birth . This timeline coincides with critical periods of synaptogenesis and circuit refinement, suggesting that mitochondrial docking becomes increasingly important as neuronal circuits mature. This developmental regulation should be considered when designing experiments with early postnatal neurons, as the effects of Snph manipulation may vary depending on developmental stage .

What are the primary phenotypic consequences of Snph gene deletion in mice?

Deletion of the Snph gene in mice results in several significant phenotypic changes:

  • Dramatically increased motility of axonal mitochondria

  • Reduced density of mitochondria in axons

  • Enhanced short-term facilitation during prolonged high-frequency stimulation

  • Altered calcium dynamics at presynaptic boutons

  • Impaired motor coordination

How are Snph knockout mice generated for research purposes?

Snph knockout mice are generated through targeted gene replacement in embryonic stem (ES) cells. The methodology involves:

  • Replacing all four protein-coding exons of the Snph gene with a PGKneo gene cassette (neomycin resistance gene under the PGK promoter)

  • Placing a herpes simplex virus-1 thymidine kinase gene under the PGK promoter at the end of the long arm of the construct

  • Linearizing and electroporating the vector into ES cell line TC1 (derived from 129/SvEvTacfBR mouse)

  • Selecting cells with G418 and fialuridine

  • Identifying homologous recombination events by Southern blot screening using a PCR-generated probe

  • Microinjecting ES cells heterozygous for the targeted mutation into C57BL/6J blastocysts

  • Breeding chimeric mice that transmit the mutation through germline transmission

Verification of gene deletion is performed through Southern blotting and Western blot analysis of brain homogenates, demonstrating dose-dependent loss of Snph protein in heterozygous and homozygous mutant animals .

What methods can be used to study Snph-mediated mitochondrial docking in live neurons?

Several effective methodologies have been developed to study Snph-mediated mitochondrial docking:

  • Live imaging of fluorescently-labeled mitochondria in cultured neurons:

    • Track individual mitochondria over time

    • Classify mitochondria as stationary or mobile based on displacement thresholds

    • Compare proportions of stationary mitochondria between wild-type and Snph knockout neurons

  • Expression of GFP-Snph fusion proteins:

    • Transfect neurons with GFP-Snph constructs

    • Perform time-lapse imaging to observe immobilization of mitochondria containing the fusion protein

  • Activity-dependent docking analysis:

    • Stimulate neurons electrically or chemically

    • Measure changes in mitochondrial mobility before and after stimulation

    • Compare these changes between wild-type and Snph-manipulated neurons

These approaches provide complementary data on Snph's role in mitochondrial docking under various experimental conditions .

What in vitro assays are available to study Snph interactions with motor proteins?

Several robust in vitro assays have been developed to study Snph interactions with motor proteins, particularly kinesin-1 (KIF5):

  • Glutathione-Sepharose binding assay:

    • Add 10 μl glutathione-Sepharose resin to 4 μg of GST-Snph or its truncated/deleted mutants

    • Incubate on ice for 30 min before adding 8 μg purified His-KIF5C

    • Incubate on ice for another 1-3 hours

    • Wash the resin four times

    • Elute bound protein with SDS sample buffer and heat at 95°C for 10 min

    • Analyze by SDS-PAGE and Western blotting

  • Coimmunoprecipitation from tissue or cultured cells:

    • Homogenize mouse brains, HEK293 cells, or cultured neurons in TBS with 1% Triton X-100 and protease inhibitors

    • Centrifuge at 13,000 g for 30 min and collect supernatant

    • Incubate lysates with 3 μg antibody in TBS with 0.1% Triton X-100 and protease inhibitors for 2 hours

    • Add Protein A-Sepharose CL-4B resin and incubate for 3 more hours

    • Wash three times with TBS/0.1% Triton X-100

    • Analyze by SDS-PAGE and Western blotting

These assays allow for detailed characterization of the molecular interactions between Snph and motor proteins that mediate mitochondrial transport .

How does Snph mechanistically achieve mitochondrial docking in axons?

Snph achieves mitochondrial docking through a dual "Engine-Switch and Brake" mechanism:

  • As a mitochondrial anchor ("brake"):

    • Snph contains a microtubule-binding domain that physically tethers mitochondria to the microtubule-based cytoskeleton

    • This physical interaction prevents mitochondrial movement along the axon

  • As a motor inhibitor ("engine off switch"):

    • Snph directly binds to the kinesin motor protein KIF5 (kinesin-1)

    • This interaction inhibits the motor's adenosine triphosphatase activity

    • By inhibiting the motor, Snph prevents it from generating the force needed for mitochondrial transport

These two mechanisms work in concert to ensure robust immobilization of mitochondria at specific sites along the axon where energy and calcium buffering are required. The interaction with both microtubules and motor proteins provides redundant mechanisms for ensuring stable docking .

How is Snph-mediated mitochondrial docking regulated by neuronal activity?

Neuronal activity regulates Snph-mediated mitochondrial docking through a calcium-dependent mechanism:

  • Neuronal activity leads to calcium influx in the axon

  • Elevated calcium levels recruit Snph to axonal mitochondria

  • The increased Snph on mitochondria enhances interaction with both microtubules and KIF5 motors

  • This motor-docking interplay results in activity-dependent immobilization of mitochondria

This process is essential for establishing an appropriate balance between motile and stationary axonal mitochondria. In Snph knockout neurons, the activity-dependent immobilization of axonal mitochondria is abolished, confirming Snph's critical role in this process. The mechanism involves sensing of mitochondrial Rho guanosine triphosphatase-Ca²⁺, which acts as a signal for motor inhibition and mitochondrial anchoring .

What role does Snph play in neuronal growth cones during development?

Snph contributes to mitochondrial positioning within neuronal growth cones:

  • Mitochondria accumulate in the growth cone central area and are also present in its periphery

  • Snph mediates mitochondrial immobilization at the growth cone through similar mechanisms as in mature axons

  • Interestingly, Snph is not required for proper growth cone morphology or axon elongation

This suggests that while Snph-mediated mitochondrial docking occurs in growth cones, it may serve functions distinct from regulating axonal outgrowth, such as providing localized energy for growth cone dynamics or calcium buffering for guidance responses. The specific contributions of Snph to growth cone function remain an area of active investigation .

How does Snph deletion affect synaptic function and plasticity?

Snph deletion has significant effects on synaptic function and plasticity:

  • Enhanced short-term facilitation during prolonged stimulation:

    • Snph knockout neurons exhibit increased facilitation of synaptic responses during high-frequency stimulation

    • This phenotype is fully rescued by reintroducing the Snph gene into mutant neurons

  • Altered calcium signaling at presynaptic boutons:

    • Reduced mitochondrial density at presynaptic sites likely affects local calcium buffering

    • Changes in calcium dynamics influence neurotransmitter release probability and short-term plasticity

  • Potential effects on energy provision:

    • Reduced mitochondrial density may affect local ATP availability

    • Energy deficits could influence synaptic vesicle cycling and recovery

These findings highlight the importance of proper mitochondrial positioning for normal synaptic function and suggest that Snph-mediated mitochondrial docking is a critical regulator of synaptic plasticity .

What is the relationship between Snph and other proteins involved in mitochondrial dynamics?

While the search results don't provide comprehensive information on Snph's relationship with all mitochondrial dynamics proteins, they reveal important interactions:

  • Snph interacts with KIF5 (kinesin-1):

    • This interaction inhibits the motor's ATPase activity

    • The coupling between Snph and KIF5 is critical for activity-dependent mitochondrial docking

  • Relationship with Drp1 and CRMP2:

    • CRMP2 (Collapsin Response Mediator Protein 2) and Drp1 are involved in mitochondrial morphology and dynamics

    • Phosphorylation states of these proteins may interact with Snph-mediated docking mechanisms

    • Treatment with (S)-lacosamide ((S)-LCM) affects CRMP2 phosphorylation but does not affect Drp1 phosphorylation

These interactions suggest Snph functions within a broader network of proteins that collectively regulate mitochondrial transport, morphology, and positioning in neurons .

How can researchers distinguish between the effects of Snph on mitochondrial transport versus other cellular processes?

Distinguishing between Snph's effects on mitochondrial transport versus other cellular processes requires careful experimental design:

  • Domain-specific mutants:

    • Generate Snph constructs with mutations in specific functional domains

    • Compare effects of wild-type Snph versus mutants that specifically disrupt microtubule binding or motor protein interaction

    • This approach helps isolate which domains are responsible for specific cellular effects

  • Cargo-specific analysis:

    • Compare transport of mitochondria versus other organelles in Snph knockout or overexpressing neurons

    • If Snph specifically affects mitochondria but not other cargoes, this supports a direct role in mitochondrial transport

  • Temporal manipulation:

    • Use inducible expression or acute knockdown of Snph to minimize developmental or compensatory effects

    • Compare acute versus chronic Snph manipulation to distinguish direct from indirect effects

  • Rescue experiments:

    • Test whether reintroduction of Snph or specific domains rescues observed phenotypes

    • These experiments can establish causality between Snph function and specific cellular outcomes

What are common challenges in expressing recombinant mouse Snph and how can they be addressed?

Expression of recombinant mouse Snph presents several technical challenges:

  • Protein solubility:

    • Full-length Snph contains hydrophobic domains that may reduce solubility

    • Solution: Express truncated versions that retain functional domains but exclude hydrophobic regions, or use appropriate detergents

  • Proper folding and function:

    • Ensuring recombinant Snph retains its ability to bind microtubules and interact with motor proteins

    • Solution: Validate function through in vitro binding assays with microtubules and motor proteins

  • Expression system selection:

    • Bacterial expression may lead to inclusion bodies

    • Solution: Optimize expression conditions (temperature, induction time) or use eukaryotic expression systems

  • Purification strategy:

    • GST-tagged or His-tagged constructs can be used for purification

    • Use glutathione-Sepharose resin for GST-Snph purification as described in the research methodology

What controls are essential when studying Snph-mediated mitochondrial docking?

Several controls are essential when studying Snph-mediated mitochondrial docking:

  • Genetic controls:

    • Compare wild-type, heterozygous, and homozygous Snph knockout models

    • Perform rescue experiments by reintroducing Snph into knockout neurons

  • Protein expression validation:

    • Verify Snph knockout by Western blot and immunostaining

    • Confirm expression levels of exogenous Snph constructs using antibodies against Snph or epitope tags

  • Domain-specific controls:

    • Include Snph constructs with mutations in microtubule-binding or motor-interacting domains

    • These serve as negative controls for specific aspects of Snph function

  • Activity-dependent controls:

    • Compare mitochondrial mobility before and after neuronal stimulation

    • Test whether activity-dependent immobilization is abolished in Snph knockout neurons

These controls help ensure that observed phenotypes are specifically attributed to Snph's role in mitochondrial docking .

What quantitative methods are recommended for analyzing mitochondrial mobility in the context of Snph research?

Several quantitative methods are recommended for analyzing mitochondrial mobility in Snph research:

  • Kymograph analysis:

    • Generate kymographs from time-lapse images of labeled mitochondria

    • Classify mitochondria as stationary or mobile based on displacement patterns

    • Calculate percentage of time mitochondria spend in motile versus stationary states

  • Particle tracking:

    • Track individual mitochondria over time using automated tracking software

    • Measure parameters such as velocity, run length, pause frequency, and directional changes

    • Compare these metrics between wild-type and Snph-manipulated conditions

  • Population-based analysis:

    • Calculate the percentage of mobile versus stationary mitochondria in each condition

    • Define "stationary" as mitochondria that move less than a threshold distance (e.g., <2 μm) during the observation period

    • Compare the density of mitochondria in different axonal regions

  • Activity-dependence quantification:

    • Measure changes in mitochondrial mobility before and after neuronal stimulation

    • Calculate the percentage of mitochondria that become stationary following stimulation

    • Compare this activity-dependent response in wild-type versus Snph knockout neurons

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.