Recombinant Mouse Syntaxin-17 (Stx17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Stx17; Syntaxin-17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSEDEEKVKLRRLEPAIQKFTKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGR TVQQLRSNIREMEKLCLKVHKDDLVLLKRMIDPVKEAAATATAEFLQLHLESVEELKKQV NDEELLQPSLTRSTTVDGVLHTGEAEAASQSLTQIYALPEIPQDQNAAESWETLEADLIE LSHLVTDMSLLVSSQQEKIDSIADHVNSAAVNVEEGTKNLQKAAKYKLAALPVAGALIGG VVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRRKQKMMEKLTSSCPDLPSQSDKKR S
Uniprot No.

Target Background

Function

SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) are crucial for cellular membrane fusion. They assemble on opposing membranes to form a trans-SNARE complex—an extended, parallel four alpha-helical bundle driving membrane fusion. Syntaxin-17 (STX17) is an autophagosomal SNARE regulating autophagy via direct control of autophagosome-lysosome membrane fusion. It may also play a role in the early secretory pathway, potentially maintaining endoplasmic reticulum-Golgi intermediate compartment (ERGIC)/Golgi architecture and/or regulating transport between the endoplasmic reticulum, ERGIC, and Golgi.

Gene References Into Functions
  1. Legionella pneumophila Lpg1137 disrupts ER-mitochondria communication by cleaving syntaxin 17. PMID: 28504273
  2. Syntaxin-17's presence in the last eukaryotic common ancestor suggests that removing damaged mitochondrial content may represent an early vesicle transport mechanism. PMID: 27458136
  3. Syntaxin 17 (Stx17) is identified as the autophagosomal SNARE essential for fusion with endosomes/lysosomes. PMID: 23217709
Database Links
Protein Families
Syntaxin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Smooth endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein. Cytoplasm, cytosol.

Q&A

Basic Research Questions

  • What is the fundamental role of Syntaxin-17 in autophagy and how does it differ from other SNARE proteins?

    Syntaxin-17 (Stx17) is a key autophagosomal SNARE protein that facilitates membrane fusion between autophagosomes and lysosomes during macroautophagy. Unlike conventional syntaxins, Stx17 has distinctive structural features including two tandem transmembrane helices forming a hairpin-like structure and a C-terminal region that is crucial for its function . Stx17 is uniquely recruited to mature (closed) autophagosomes but not to immature (unclosed) structures, providing a critical temporal regulation mechanism that prevents premature fusion with lysosomes . This temporal regulation is essential because if lysosomes were to fuse with intermediate unclosed structures and their inner membrane were degraded, harmful lysosomal enzymes would leak into the cytosol . Methodologically, researchers can study this regulation by using fluorescently tagged constructs (like mGFP-STX17TM) to visualize the recruitment dynamics to LC3B-positive autophagosomes .

  • What structural domains characterize mouse Syntaxin-17 and how do they contribute to its function?

    Mouse Syntaxin-17 has a distinct domain architecture consisting of: 1) an N-terminal Habc domain; 2) a SNARE domain responsible for interaction with other SNARE proteins; 3) two tandem transmembrane helices that insert into the autophagosomal membrane; and 4) a short C-terminal cytosolic region . The C-terminal region contains positively charged amino acids that are critical for membrane targeting, as demonstrated by experiments showing that deletion of this region (TMΔC) results in diffuse cytosolic localization rather than autophagosomal recruitment . The transmembrane helices also play a role in membrane specificity, creating a "coincidence detector" mechanism where both the cationic motif in the C-terminal region and the membrane-anchored transmembrane helices are required for proper targeting to autophagosomal membranes .

  • How conserved is Syntaxin-17 across different species, and what functional implications do these differences have?

    Syntaxin-17 is one of the six ancient SNARE paralogs present in diverse eukaryotic organisms but has been lost in multiple lineages during evolution . While its role in autophagosome-lysosome fusion is conserved in mammals, Drosophila melanogaster (Dm), and Caenorhabditis elegans (Ce), there are notable structural and functional differences . The C-terminal region shows poor sequence conservation across species, with mammalian and nematode Stx17 containing positively charged amino acids, whereas fly Stx17 is enriched in negatively charged residues . Despite these differences, when expressed in mammalian cells, both DmSTX17TM and CeSTX17TM can still be recruited to autophagosomes, albeit less efficiently than human STX17 . Functionally, these differences translate to varying roles: fly Stx17 predominantly localizes to the cytosol and mediates autophagy but not mitochondrial division, while nematode Stx17 is predominantly present in mitochondria and facilitates mitochondrial division but is less involved in autophagy .

  • What techniques are most effective for detecting and visualizing endogenous Syntaxin-17 in mouse tissue samples?

    For detecting endogenous Syntaxin-17 in mouse tissue samples, researchers can employ several complementary techniques. Western blotting using specific antibodies (like Rabbit mAb #31261) at a dilution of 1:1000 is effective for quantitative analysis, with Stx17 appearing at approximately 33 kDa . For spatial localization, immunohistochemistry on paraffin-embedded sections (IHC-P) and immunofluorescence (IF) can be performed using validated antibodies such as ab229646 at appropriate dilutions . To study protein-protein interactions, immunoprecipitation protocols using 1:100 dilution of antibodies followed by Western blotting can be employed . For higher resolution analysis, proximity ligation assays (PLA) are valuable for detecting interactions between Stx17 and other proteins like Drp1 . When designing experiments, it's crucial to include appropriate controls: Stx17 knockout cells or tissues serve as negative controls, while known interaction partners can serve as positive controls for co-immunoprecipitation studies .

  • What are the established methods for generating functional recombinant mouse Syntaxin-17 for in vitro studies?

    Generating functional recombinant mouse Syntaxin-17 for in vitro studies requires careful consideration of expression systems and purification strategies. Based on research methodologies, the following approach has been demonstrated to be effective: cDNAs encoding mouse Stx17 can be inserted into expression vectors like pMRXIP (with puromycin-resistant marker), pMRXIZ (with zeocin-resistant marker), or pMRXIB (with blasticidin-resistant marker) together with fluorescent tags such as enhanced GFP or mRuby3 . For protein expression, insect cell systems have been successfully used to produce recombinant Stx17 constructs . Truncated versions containing only the transmembrane helices and the C-terminal region (STX17TM) behave similarly to full-length STX17 and are often used to avoid detecting indirect effects of SNARE domain-mediated translocation . Point mutations can be generated by PCR-mediated site-directed mutagenesis to study specific functional regions . For purification, standard chromatography techniques followed by validation of protein folding and membrane insertion capability are recommended, as the proper folding of the transmembrane helices is critical for function.

Intermediate Research Questions

  • How does the temporal regulation of Syntaxin-17 recruitment to autophagosomes occur at the molecular level?

    The temporal regulation of Syntaxin-17 recruitment to autophagosomes is governed by an electrostatic mechanism involving the autophagosomal membrane and Stx17's C-terminal region. Research has revealed that mature autophagosomes become more negatively charged compared to unclosed intermediate structures, likely due to the accumulation of phosphatidylinositol 4-phosphate (PI4P) . This electrostatic maturation creates an environment that attracts the positively charged C-terminal region of Stx17. Methodologically, this can be studied using membrane surface charge probes constructed with oligonucleotides inserted into plasmids with enhanced GFP . The importance of PI4P in this process has been demonstrated through in vitro experiments where autophagosomes isolated from STX17 knockout cells were treated with the PI4P phosphatase Sac1PD, which significantly impaired the association of recombinant mGFP-STX17TM with autophagosomes. Importantly, the phosphatase-dead mutant Sac1PD (C392S) showed no effect, confirming the specificity of PI4P's role . This PI4P-driven mechanism explains how Stx17 specifically recognizes mature autophagosomes over immature ones.

  • What methodological approaches can be used to study the interaction between Syntaxin-17 and PI4P in autophagosomal membranes?

    To study the interaction between Syntaxin-17 and PI4P in autophagosomal membranes, researchers can employ multiple complementary approaches. One effective method is to isolate mature autophagosomes from STX17 knockout cells as demonstrated in published protocols, followed by in vitro reconstitution assays with recombinant Stx17 and PI4P-modifying enzymes . Specifically, isolated autophagosomes can be incubated with recombinant Sac1PD (a PI4P phosphatase) or its phosphatase-dead mutant (C392S) as a control, followed by addition of fluorescently tagged STX17TM . Molecular dynamics simulations provide another powerful approach, using all-atom models for STX17TM and the highly mobile membrane-mimetic (HMMM) model for lipid bilayers with varying compositions (e.g., PC:PE:PI4P=70:20:10 versus PC:PE=70:30) . These simulations can track STX17TM movement and membrane insertion over defined time scales (e.g., 100 ns). For cellular studies, researchers can employ PI4P-specific biosensors coupled with live-cell imaging to visualize PI4P dynamics during autophagosome maturation, or use PI 4-kinase inhibitors like NC03 to modulate PI4P levels, although the latter has shown limited efficacy in affecting autophagosomal PI4P levels .

  • How can researchers distinguish between the three distinct states of Syntaxin-17's SNARE motif in experimental settings?

    Distinguishing between the three distinct states of Syntaxin-17's SNARE motif (autoinhibited, GABARAP-bound, and SNARE complex-incorporated) requires a combination of biochemical, structural, and imaging approaches. For the autoinhibited state, researchers can employ NMR spectroscopy to detect the direct interaction between the Habc domain and the Qa-SNARE motif . To identify the GABARAP-bound state, crystal structure determination of the Syntaxin-17 LIR-GABARAP complex provides definitive evidence, while in cellular contexts, co-immunoprecipitation and proximity ligation assays can detect this interaction . The SNARE complex-incorporated state can be studied through biochemical reconstitution of the SNARE complex with SNAP29 and VAMP8, followed by SDS-PAGE analysis (as SNARE complexes are often SDS-resistant) or FRET-based assays to monitor complex formation in real-time . Fluorescence microscopy with differentially tagged Syntaxin-17 constructs can also help visualize these states in cells, particularly when combined with temporal analysis during autophagosome maturation. Importantly, researchers should consider using Syntaxin-17 mutants that preferentially stabilize one state, such as mutations in the Habc domain that disrupt the autoinhibited state, or LIR motif mutations that prevent GABARAP binding .

  • What are the experimental challenges in studying the dynamic recruitment of Syntaxin-17 to autophagosomes, and how can they be overcome?

    Studying the dynamic recruitment of Syntaxin-17 to autophagosomes presents several experimental challenges. One major difficulty is the transient nature of autophagosome formation and maturation, making it challenging to capture the precise moment of Stx17 recruitment. To overcome this, researchers can employ live-cell imaging with photoactivatable or photoconvertible fluorescent tags fused to Stx17, allowing for temporal control of visualization . Another challenge is distinguishing Stx17 on mature autophagosomes from other membrane compartments where it might be present. This can be addressed by using multiple markers: LC3B for general autophagosome labeling combined with markers for autophagosome maturation state . The manipulation of PI4P levels specifically on autophagosomes presents another challenge, as global PI4P depletion affects multiple cellular compartments. An in vitro approach using isolated autophagosomes treated with the PI4P phosphatase Sac1PD provides a more controlled system . Additionally, detecting subtle changes in membrane surface charge is difficult using conventional techniques. Researchers have addressed this by developing membrane surface charge probes constructed using specific oligonucleotides inserted into plasmids with enhanced GFP . Finally, the potential influence of overexpression artifacts can be mitigated by creating cell lines with endogenously tagged Stx17 using CRISPR-Cas9 technology.

  • How does Syntaxin-17 function differ between autophagy and mitochondrial dynamics contexts?

    Syntaxin-17 exhibits context-dependent functionality between autophagy and mitochondrial dynamics, with species-specific variations in these roles. In autophagy, Stx17 primarily functions as a SNARE protein that mediates autophagosome-lysosome fusion by interacting with SNAP29 and VAMP7/8 . This requires its recruitment to mature autophagosomes via the positively charged C-terminal region's interaction with PI4P-enriched autophagosomal membranes . In mitochondrial dynamics, mammalian and nematode Stx17 promote mitochondrial fission by interacting with Drp1 (a key mitochondrial fission protein), preventing its inactivation by PKA and supporting its activation via protein phosphatase PGAM5 . To experimentally distinguish between these functions, researchers can employ several approaches: (1) Proximity ligation assays (PLA) to detect specific interactions with either autophagy partners (SNAP29, VAMP8) or mitochondrial partners (Drp1) ; (2) Rescue experiments in Stx17-depleted cells using species-specific Stx17 variants or domain mutants to identify critical regions for each function ; (3) Quantitative analysis of mitochondrial length together with autophagy flux measurements to assess function in both pathways simultaneously . Intriguingly, fly Stx17 predominantly mediates autophagy but not mitochondrial division, while nematode Stx17 primarily facilitates mitochondrial division with less involvement in autophagy, highlighting evolutionary divergence in Stx17 functions .

Advanced Research Questions

  • How can molecular dynamics simulations be optimized to accurately predict Syntaxin-17's membrane insertion behavior?

    Optimizing molecular dynamics (MD) simulations for accurate prediction of Syntaxin-17's membrane insertion behavior requires careful consideration of multiple parameters. Based on successful approaches documented in research, the following methodology is recommended: Begin with structural prediction of STX17TM using deep learning methods like trRosetta, which can generate multiple structural models (TM score >0.7) to account for conformational variability . For the lipid bilayer simulation, the highly mobile membrane-mimetic (HMMM) model is advantageous as it facilitates lateral diffusion more efficiently than standard all-atom models while faithfully representing the membrane surface . Test multiple lipid compositions to capture physiological relevance, such as POPC:POPE:POPI4P=70:20:10 (with PI4P), POPC:POPE=70:30 (without PI4P), and POPC:POPE:POPI=70:20:10 (with PI instead of PI4P) . Set up the initial configuration with the center of mass of STX17TM located approximately 3 nm above the membrane surface, with the first principal axis tilted 45 degrees from the z-axis . Solvate the protein and lipids in an appropriately sized box (e.g., 10 nm × 10 nm × 30 nm) using the TIP3P water model and physiological ionic conditions (0.15 M KCl) . Run simulations for at least 100 ns to observe insertion events, and conduct multiple independent simulations with different predicted structures to ensure robustness of findings . Key measurements should include tracking the position of transmembrane helices relative to the membrane, monitoring electrostatic interactions between the C-terminal positively charged region and membrane phospholipids, and assessing membrane deformation during the insertion process.

  • What role does the autoinhibited state of Syntaxin-17 play in regulating its function, and how can this be experimentally manipulated?

    The autoinhibited state of Syntaxin-17 plays a crucial regulatory role in preventing premature SNARE complex formation and ensuring proper temporal control of autophagosome-lysosome fusion. Research has shown that Stx17 alone adopts an autoinhibited conformation mediated by a direct interaction between its Habc domain and the Qa-SNARE motif . This closed conformation prevents the SNARE motif from engaging with other SNARE proteins until the appropriate time. To experimentally manipulate and study this autoinhibited state, researchers can employ several strategies: (1) Generate targeted mutations in the Habc domain or the Qa-SNARE motif that disrupt their interaction, creating constitutively active Stx17 variants ; (2) Develop truncation constructs lacking the Habc domain to bypass autoinhibition; (3) Utilize GABARAP binding to release the autoinhibited state, as research has shown that GABARAP interaction with Stx17's LC3-interacting region (LIR) motif can disrupt the closed conformation ; (4) Apply FRET-based biosensors incorporating both the Habc domain and SNARE motif to monitor conformational changes in real-time within living cells; (5) Perform in vitro binding assays with purified components to quantitatively assess the strength of intramolecular interactions and identify compounds that might modulate this state. Understanding and manipulating the autoinhibited state provides insights into how Stx17 activation is coordinated with autophagosome maturation and could potentially be targeted for therapeutic interventions in diseases with dysregulated autophagy.

  • How can researchers design experiments to resolve contradictions in the literature regarding mechanisms of Syntaxin-17 recruitment to autophagosomes?

    Resolving contradictions in the literature regarding Syntaxin-17 recruitment mechanisms requires systematic experimental approaches that address specific points of contention. One major contradiction concerns the role of LC3/GABARAP family proteins in Stx17 recruitment, with some studies reporting their involvement while others showing they are not required . To resolve this, researchers should design experiments with the following components: (1) Use multiple cell lines with CRISPR-Cas9-mediated knockout of all LC3/GABARAP family members to definitively test their necessity; (2) Employ super-resolution microscopy with spatial and temporal resolution to track the order of recruitment events; (3) Develop in vitro reconstitution systems using purified components to test direct interactions versus cooperative mechanisms; (4) Create chimeric constructs between the contradictory model systems to identify critical determinants. Another contradiction involves the role of phosphorylation and protein-protein interactions (with filamin A) versus the PI4P-dependent membrane charge model . To address this, researchers should: (1) Generate phosphomimetic and phospho-deficient mutants of STX17 at relevant sites; (2) Use liposome-binding assays with varying PI4P concentrations and ionic strengths (as demonstrated by the study showing that STX17TM association with liposomes is blocked in high ionic buffer ); (3) Perform epistasis experiments where both PI4P levels and kinases/phosphatases are simultaneously manipulated; (4) Develop computational models that integrate multiple recruitment mechanisms to predict experimental outcomes under various conditions. By systematically addressing these contradictions with multifaceted approaches, researchers can develop a more unified model of Stx17 recruitment.

  • What methodological approaches can identify the physiological significance of the temporal regulation of Syntaxin-17 recruitment in different disease contexts?

    Investigating the physiological significance of temporal regulation of Syntaxin-17 recruitment in disease contexts requires integrated approaches spanning from molecular manipulation to organismal phenotypes. For neurodegenerative diseases, where autophagic defects are common, researchers can: (1) Generate mouse models expressing Stx17 variants with mutations in the C-terminal positively charged region that alter its temporal recruitment to autophagosomes ; (2) Employ inducible expression systems to acutely manipulate Stx17 levels or functionality in specific brain regions at defined disease stages; (3) Utilize in vivo imaging of fluorescently tagged Stx17 in conjunction with autophagy markers to monitor recruitment dynamics in disease-affected tissues. For methamphetamine-induced neurotoxicity, where Stx17 overexpression has been shown to rescue cognitive impairment and synaptic loss , researchers should: (1) Quantify the overlap between Stx17 and autophagosomes in control versus methamphetamine-exposed neurons; (2) Measure changes in autophagosomal PI4P levels during drug exposure; (3) Assess whether altering PI4P levels can modulate methamphetamine toxicity. For cancer models, where autophagy often plays a dual role, researchers can: (1) Compare Stx17 recruitment dynamics between normal and cancer cells; (2) Correlate alterations in Stx17 recruitment timing with autophagic flux and treatment response; (3) Develop therapeutic strategies targeting Stx17 recruitment specifically in cancer cells through localized manipulation of PI4P levels. Across all disease contexts, combining biochemical readouts (e.g., cargo degradation efficiency, lysosomal enzyme activity) with physiological and behavioral assessments will provide comprehensive insights into how dysregulated Stx17 recruitment impacts disease progression.

  • How does the interplay between Syntaxin-17 and other SNARE proteins dynamically regulate membrane fusion events in autophagy?

    The dynamic interplay between Syntaxin-17 and other SNARE proteins in regulating autophagosomal membrane fusion represents a complex choreography that ensures fusion occurs at the right time and place. To methodically investigate this interplay, researchers should employ multiple complementary approaches: (1) Perform sequential immunoprecipitation experiments to isolate and characterize intermediate SNARE complexes during autophagosome maturation, particularly focusing on the temporal assembly of Stx17-SNAP29-VAMP8/7 complexes ; (2) Use FRET-based biosensors designed to detect SNARE complex formation in real-time within living cells, allowing for precise temporal resolution of assembly events; (3) Implement optogenetic approaches to acutely manipulate Stx17 activity at specific stages of autophagosome maturation; (4) Utilize in vitro reconstitution systems with purified components to determine the kinetics and energetics of SNARE complex assembly under different conditions (e.g., varying PI4P concentrations, presence of regulatory proteins); (5) Employ cryo-electron tomography to visualize membrane contact sites during fusion events at nanometer resolution. Recent research has revealed that two distinct SNARE complexes operate in autophagosome-lysosome fusion: Stx17-SNAP29-VAMP7/8 and YKT6-SNAP29-STX7 . These systems appear to function in parallel but are regulated differently—STX17 through PI4P-dependent recruitment and YKT6 through ULK1-mediated phosphorylation . Understanding how these parallel systems coordinate and potentially compensate for each other will provide crucial insights into the resilience and precision of autophagosomal fusion machinery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.