Recombinant Mouse Syntaxin-1B (Stx1b)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

Syntaxin-1B (Stx1b) is encoded by the Stx1b gene (Gene ID: 56216) in mice . The gene produces several transcript variants, with the main protein consisting of 288 amino acids that functions as a critical neuronal target membrane SNARE protein (t-SNARE) . The protein is primarily located at the plasma membrane of neuronal tissues and serves as a key component in the SNARE complex, which is responsible for vesicle fusion during neurotransmitter release .

Recombinant Mouse Syntaxin-1B protein can be produced in mammalian cell expression systems, typically incorporating a His-tag for purification purposes. The recombinant protein exhibits high purity (>80%) when produced using standard methods and is typically stored in PBS buffer .

FeatureSpecification
SourceMammalian Cells
TagHis
FormLiquid or lyophilized powder
Endotoxin< 1.0 EU per μg of protein (LAL method)
Purity>80%
Storage BufferPBS buffer
Storage Conditions+4°C (short term), -20°C to -80°C (long term)
Gene ID56216
mRNA RefseqNM_024414.2
Protein RefseqNP_077725.1
UniProt IDP61264

Role in Synaptic Transmission

Syntaxin-1B plays a critical role in regulating synaptic vesicle exocytosis and neurotransmitter release. Research has demonstrated that Syntaxin-1B, but not Syntaxin-1A, is necessary for proper regulation of spontaneous and evoked synaptic vesicle exocytosis in fast transmission . The protein functions as part of the SNARE complex, which includes SNAP-25 and synaptobrevin/VAMP, forming a molecular machinery that drives membrane fusion during neurotransmitter release .

Distribution in the Nervous System

The expression patterns of Syntaxin-1A and Syntaxin-1B in the central nervous system (CNS) and peripheral nervous system (PNS) of adult rodents do not completely overlap, suggesting specialized functions in different neuronal populations . This differential distribution pattern provides further evidence for the distinct physiological roles of these paralogs in neuronal communication and may explain why Syntaxin-1B cannot be functionally compensated by Syntaxin-1A in certain neuronal circuits .

Survival Impact

Complete removal of Syntaxin-1B in mice causes premature death, with animals dying within two weeks of birth . Additionally, selective removal of Syntaxin-1B from forebrain excitatory neurons also results in premature death, highlighting the essential nature of this protein for postnatal survival .

Effects on Neurotransmission

Detailed electrophysiological studies in Syntaxin-1B knockout models have revealed multiple deficits in synaptic transmission:

  1. Reduced frequency of spontaneous quantal release in both glutamatergic and GABAergic synapses .

  2. Increased paired-pulse ratio of evoked postsynaptic currents, indicating altered presynaptic release probability .

  3. Accelerated synaptic vesicle turnover in glutamatergic synapses .

  4. Decreased size of the readily releasable pool in both glutamatergic and GABAergic synapses .

Moreover, when both Syntaxin-1A and Syntaxin-1B are deleted (double knockout), neurons exhibit severely reduced and asynchronous evoked synaptic vesicle release in both glutamatergic and GABAergic synapses .

Impact on Neuromuscular Junction Function

Studies focusing on the neuromuscular junction (NMJ) have shown that while Syntaxin-1B is dispensable for the formation of mouse NMJs, it is required to maintain efficient neurotransmission at the nerve-muscle synapse . This finding further distinguishes Syntaxin-1B from Syntaxin-1A and emphasizes its importance in peripheral synaptic function.

Neurotransmission Studies

Recombinant Mouse Syntaxin-1B serves as a valuable tool for investigating fundamental mechanisms of neurotransmitter release and synaptic vesicle exocytosis. The protein can be used in reconstitution assays to study SNARE-mediated membrane fusion processes and to examine protein-protein interactions involved in the regulation of synaptic transmission .

Behavioral and Addiction Research

Interestingly, studies have linked Syntaxin-1B to ethanol preference drinking behaviors in mice. Research using B6 x D2 recombinant inbred strains has detected provisional associations between Syntaxin-1B molecular variants and ethanol consumption, as well as other ethanol-related traits, including severity of acute ethanol withdrawal, ethanol-conditioned taste aversion, and ethanol-induced hypothermia . These findings suggest potential applications of Recombinant Mouse Syntaxin-1B in addiction research and alcohol-use disorders.

Expression Systems and Purification

Recombinant Mouse Syntaxin-1B can be produced using various expression systems, with mammalian cell-based production being common for obtaining properly folded and functionally active protein . The recombinant protein typically incorporates affinity tags, such as His-tags, to facilitate purification via affinity chromatography methods .

Custom Production and Applications

Commercial production of Recombinant Mouse Syntaxin-1B often requires custom manufacturing with lead times between 5-9 weeks . The protein can be produced according to specific research requirements, including different fusion tags, expression systems, and purification protocols to meet the needs of diverse experimental applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Stx1b; Stx1b1; Stx1b2; Syntaxin-1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL
Uniprot No.

Target Background

Function
Syntaxin-1B is potentially involved in synaptic vesicle docking at presynaptic active zones and may mediate calcium-regulated exocytosis, such as the acrosomal reaction in sperm.
Gene References Into Functions
  1. Studies using Stx1b+/- mice revealed reduced GABA release in vitro and in vivo, disrupting the central nervous system's dopaminergic system and resulting in reduced pre-pulse inhibition. PMID: 29139159
  2. Research indicates that STX1B is crucial for neuronal survival in vitro and plays a critical role in neurotransmission at mouse neuromuscular junctions. PMID: 26203110
  3. STX1B is important for neuronal survival, potentially by regulating the secretion of neurotrophic factors. PMID: 24666284
  4. Evidence suggests that the closed conformation of syntaxin-1 regulates the initiation of synaptic vesicle fusion, a process mediated by SNARE-complex/Munc18-1 assemblies. PMID: 18703708
Database Links
Protein Families
Syntaxin family
Subcellular Location
Membrane; Single-pass type IV membrane protein.

Q&A

What is the molecular structure and cellular localization of Syntaxin-1B?

Syntaxin-1B is a 288 amino acid protein with a calculated molecular weight of 33 kDa, though it is often observed at 33-35 kDa in experimental contexts . The protein contains specific domains that facilitate its interaction with other SNARE proteins and regulatory molecules. STX1B is primarily expressed in neuronal tissues, with particularly high expression in brain regions. Electron microscopy studies of STX1B in hippocampal synapses reveal its critical role in synaptic vesicle docking at active zones. Studies comparing wild-type and STX1B-null synapses show that the number of docked synaptic vesicles per μm of active zone length is significantly reduced in STX1B-null synapses (p = 0.006) . Additionally, the distribution of synaptic vesicles differs significantly within 0-50 nm from the active zone in STX1B-null synapses compared to wild-type (p = 0.03) .

How is Syntaxin-1B involved in the SNARE complex functioning?

Syntaxin-1B operates within the SNARE complex, which mediates vesicle fusion in diverse vesicular transport processes along the exocytic and endocytic pathways . As a t-SNARE, STX1B on the target membrane interacts with vesicle-associated membrane proteins to facilitate membrane fusion. Research comparing STX1A and STX1B null mutants has revealed that STX1B plays a more critical role in regulating both spontaneous and evoked synaptic vesicle exocytosis in fast transmission systems . Analysis of STX1B knockout models shows decreased frequency of spontaneous quantal release and significantly greater paired-pulse ratios of evoked postsynaptic currents in both glutamatergic and GABAergic synapses. Furthermore, deletion of STX1B accelerates synaptic vesicle turnover in glutamatergic synapses and decreases the size of the readily releasable pool in both glutamatergic and GABAergic synapses .

What antibodies are available for detecting mouse Syntaxin-1B and what are their optimal applications?

Several validated antibodies are available for detecting mouse Syntaxin-1B in various experimental applications. The selection of appropriate antibodies depends on the specific research questions and methodologies. For instance, Proteintech offers both monoclonal and recombinant antibodies targeting STX1B with different application profiles.

The Rabbit Recombinant STX1B antibody (83298-1-RR) is validated for Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence/Immunocytochemistry (IF/ICC), Flow Cytometry (FC), and ELISA applications with reactivity to human and mouse samples . Recommended dilutions vary by application:

ApplicationDilution
Western Blot (WB)1:5000-1:50000
Immunohistochemistry (IHC)1:1000-1:4000
Immunofluorescence (IF)/ICC1:500-1:2000
Flow Cytometry (FC) (INTRA)0.25 ug per 10^6 cells in 100 μl suspension

Additionally, a Mouse Monoclonal antibody (66437-1-Ig) targeting both Syntaxin 1A and Syntaxin 1B is available with broader species reactivity (human, mouse, rat, rabbit, and pig) . This antibody has been cited in multiple published studies for various applications including Western blot and immunofluorescence.

What are the optimal protocols for Western blot detection of Syntaxin-1B?

For optimal Western blot detection of Syntaxin-1B, researchers should consider both antibody selection and protocol optimization. The expected molecular weight for STX1B is approximately 33 kDa, though it may also be observed at 55 kDa in some experimental contexts . When using the Rabbit Recombinant STX1B antibody (83298-1-RR), a dilution range of 1:5000-1:50000 is recommended .

For sample preparation, whole-brain homogenates have been successfully used in STX1B detection, as demonstrated in studies comparing wild-type, heterozygous, and homozygous knockout mice . When blotting for STX1B, reducing conditions are typically employed. R&D Systems has validated their Mouse Anti-Human/Mouse/Rat Syntaxin 1B Monoclonal Antibody (MAB6848) at 1 μg/mL concentration using PVDF membrane and HRP-conjugated secondary antibody, successfully detecting STX1B at approximately 33 kDa in various cell lines including SH-SY5Y human neuroblastoma, Neuro-2A mouse neuroblastoma, and NRK rat normal kidney cells .

For quantitative analysis, STX1B expression levels can be compared across different genotypes using methods such as one-way ANOVA with Tukey's test, as demonstrated in published research .

How can I optimize immunofluorescence protocols for visualizing Syntaxin-1B in mouse brain samples?

For immunofluorescence detection of Syntaxin-1B in mouse brain tissues, several optimizations are critical for successful visualization. When using recombinant antibodies like 83298-1-RR, a dilution range of 1:500-1:2000 is recommended for IF/ICC applications . For the monoclonal antibody 66437-1-Ig, which detects both STX1A and STX1B, a dilution range of 1:200-1:800 is suggested for IF-P (immunofluorescence on paraffin sections) .

Antigen retrieval is particularly important for optimal results. For IHC applications, it is suggested to use TE buffer at pH 9.0, though citrate buffer at pH 6.0 may be used as an alternative . This recommendation likely applies to immunofluorescence preparations as well.

Mouse brain tissue has been successfully used for IF detection of STX1B, particularly in studies focusing on neuronal structures. Given the high expression of STX1B in presynaptic terminals, co-staining with markers for synaptic structures can provide valuable context for localization studies. For analyzing synaptic density in specific brain regions such as the hippocampal CA1, electron microscopy combined with immunogold labeling has been employed to quantify synapse density differences between wild-type and STX1B knockout samples .

How do STX1B knockout models affect synaptic vesicle dynamics and what methodologies are best for studying these effects?

STX1B knockout models reveal significant alterations in synaptic vesicle dynamics that can be studied through several specialized methodologies. Studies of STX1B null mutant mice have demonstrated multiple synaptic abnormalities including decreased frequency of spontaneous quantal release, increased paired-pulse ratio of evoked postsynaptic currents, accelerated synaptic vesicle turnover in glutamatergic synapses, and decreased size of the readily releasable pool in both glutamatergic and GABAergic synapses .

Electrophysiology methods, particularly whole-cell patch-clamp recordings, are essential for functional analyses. These techniques allow measurement of spontaneous and evoked synaptic currents in both glutamatergic and GABAergic synapses, revealing the functional consequences of STX1B deletion on neurotransmission. Paired-pulse facilitation protocols have been particularly informative in demonstrating altered presynaptic release probability in STX1B knockout neurons .

How do the functional roles of STX1B differ across different synapse types and what techniques can differentiate these roles?

To differentiate STX1B roles across synapse types, researchers can employ a combination of techniques:

  • Electrophysiological recordings with pharmacological isolation: By using specific receptor antagonists (e.g., CNQX/AP5 for glutamatergic transmission, bicuculline/picrotoxin for GABAergic transmission), researchers can selectively examine STX1B function in each synapse type.

  • Immunofluorescence co-localization with synapse-specific markers: Double labeling with vGLUT1 (glutamatergic) or vGAT (GABAergic) markers alongside STX1B can reveal differential distribution patterns.

  • Synapse-specific genetic manipulations: Using Cre-loxP systems with promoters specific to excitatory or inhibitory neurons allows for targeted deletion of STX1B in specific neuron populations.

These approaches collectively provide a more comprehensive understanding of how STX1B functions may be specialized across different synapse types, informing our understanding of synaptic specificity in neurotransmission mechanisms.

What molecular mechanisms underlie the different phenotypes observed between STX1A and STX1B knockout models?

The striking phenotypic differences between STX1A and STX1B knockout models (normal development versus early postnatal lethality) suggest distinct molecular mechanisms despite their structural similarities . Several mechanisms likely contribute to these differences:

First, differential expression patterns may partially explain the divergent phenotypes. While both isoforms are coexpressed in most central and peripheral nervous systems, some regions show preferential expression of one isoform. For instance, nerve terminals of sensory neurons reaching the spinal cord are particularly rich in STX1A, while motor endplates and muscle spindles preferentially express STX1B . These distribution differences likely contribute to the more severe consequences of STX1B deletion.

Second, functional studies suggest that STX1B plays a more critical role in regulating both spontaneous and evoked synaptic vesicle exocytosis in fast transmission systems . STX1A/1B double null neurons show severely reduced and asynchronous evoked synaptic vesicle release in both glutamatergic and GABAergic synapses, but STX1A nulls alone don't show these deficits, suggesting STX1B can compensate for STX1A absence but not vice versa .

Third, differences in protein-protein interactions may exist. While both interact with the core SNARE machinery, their interactions with regulatory proteins might differ, leading to distinct functional outcomes. Comprehensive protein interaction studies comparing STX1A and STX1B interactomes would help elucidate these differences.

For studying these mechanisms, approaches combining biochemical interaction assays, high-resolution imaging of protein localization, and functional electrophysiology provide the most comprehensive insights into the non-redundant roles of these syntaxin isoforms.

What are common technical challenges in STX1B detection and how can they be addressed?

Researchers working with STX1B may encounter several technical challenges that require specific optimization strategies:

  • Antibody cross-reactivity: Due to the high sequence homology between STX1A and STX1B (approximately 84% identity), antibody cross-reactivity is a common issue. To address this, researchers should select antibodies specifically validated for STX1B detection, such as the recombinant antibody 83298-1-RR . For applications requiring distinction between STX1A and STX1B, validation using knockout controls is essential, as demonstrated in studies comparing wild-type and STX1B knockout samples .

  • Optimal fixation for immunohistochemistry: For brain tissue samples, correct fixation and antigen retrieval are critical. The recommended approach includes antigen retrieval with TE buffer at pH 9.0, though citrate buffer at pH 6.0 may be used as an alternative . For difficult samples, titration of antibody concentrations and testing different antigen retrieval conditions may be necessary.

  • Western blot optimization: STX1B is typically detected at 33-35 kDa, though it may also appear at 55 kDa in some contexts . Using reducing conditions and appropriate protein loading amounts (typically 20-50 μg of total protein) helps ensure successful detection. Additionally, optimizing transfer conditions for these membrane proteins is important, with PVDF membranes often providing better results than nitrocellulose for STX1B detection .

  • Detection in complex samples: For identifying STX1B in complex neuronal preparations, using positive control samples is recommended. Successfully tested samples include Y79 cells, SH-SY5Y cells, and mouse brain tissue .

How should experiments be designed to distinguish between STX1A and STX1B functions in synaptic transmission?

Designing experiments to distinguish between STX1A and STX1B functions requires a multifaceted approach incorporating genetic, molecular, and electrophysiological techniques:

  • Genetic manipulation strategies: Using knockout models provides the clearest distinction between isoform functions. STX1A knockout, STX1B knockout, and STX1A/1B double knockout models allow for comparative analysis of synaptic phenotypes . Additionally, RNAi-mediated knockdown combined with rescue experiments using exogenous STX1A or STX1B can help determine functional redundancy and specificity.

  • Isoform-specific antibodies: For localization studies, using isoform-specific antibodies allows for direct comparison of STX1A and STX1B distribution patterns. Validation of antibody specificity using knockout controls is essential for interpretation.

  • Electrophysiological analysis: Comprehensive electrophysiological characterization using whole-cell patch-clamp recordings can reveal functional differences. Parameters to measure include:

    • Spontaneous release frequency and amplitude

    • Evoked release amplitude and kinetics

    • Paired-pulse ratios at different intervals

    • Readily releasable pool size

    • Release probability

    • Short-term plasticity characteristics

  • Synapse-specific analyses: Examining effects in both glutamatergic and GABAergic synapses, as well as in different brain regions, can reveal synapse-specific functions of each isoform. This is particularly important given the differential distribution patterns observed between STX1A and STX1B in some neural circuits .

When interpreting results, researchers should consider that complete knockout of STX1B causes early postnatal lethality, necessitating the use of conditional knockout approaches or early developmental time points for analysis of null mutants .

What are the critical considerations when comparing data across different STX1B detection methods?

When comparing data generated using different STX1B detection methods, several critical considerations must be addressed to ensure valid interpretations:

  • Method sensitivity and specificity: Different detection methods (Western blot, immunofluorescence, flow cytometry) have inherent differences in sensitivity and specificity. Western blot provides information about protein size but limited spatial resolution, while immunofluorescence offers spatial context but may be more susceptible to background issues. Flow cytometry provides quantitative data at the cellular level but loses tissue architecture information. Understanding these trade-offs is essential when integrating data across methods.

  • Antibody considerations: Different antibodies may recognize distinct epitopes of STX1B, potentially leading to varying detection patterns. For instance, antibodies targeting different domains might be differentially affected by protein-protein interactions or post-translational modifications. When comparing data using different antibodies, researchers should note the specific antibody clones, host species, and target epitopes. The search results indicate several available antibodies with different characteristics, such as the Rabbit Recombinant STX1B antibody (83298-1-RR) and Mouse Monoclonal antibody (66437-1-Ig) .

  • Sample preparation variations: Different preparation methods can affect STX1B detection. For Western blots, various lysis buffers and reducing conditions might yield different results. For immunostaining, fixation methods, antigen retrieval procedures, and permeabilization protocols can significantly impact epitope accessibility. Standardizing these variables or accounting for them when comparing across studies is essential.

  • Quantification approaches: When quantifying STX1B levels, different normalization strategies might be employed (e.g., normalizing to total protein, housekeeping proteins, or specific neuronal markers). Additionally, detection methods vary in their linear range of quantification. For meaningful comparisons, similar quantification approaches should be used, or appropriate mathematical transformations applied.

  • Controls validation: Each detection method requires specific controls. For Western blots, loading controls and specificity controls (e.g., knockout samples) are essential. For immunostaining, secondary-only controls and knockout tissue controls help establish specificity. When comparing across methods, the robustness of controls used for each method should be evaluated.

What new approaches are emerging for studying STX1B dynamics in living systems?

Several innovative approaches are emerging for studying STX1B dynamics in living systems, enhancing our understanding of its real-time functions:

  • Live-cell imaging with fluorescent protein fusions: By creating STX1B fused to fluorescent proteins (e.g., GFP, mCherry), researchers can directly visualize STX1B trafficking and localization in living neurons. These approaches, combined with high-resolution microscopy techniques like total internal reflection fluorescence (TIRF) microscopy, allow for visualization of STX1B dynamics specifically at the plasma membrane and synaptic sites.

  • Optogenetic control of STX1B function: Emerging optogenetic tools allow for precise temporal control of STX1B activity. By engineering light-sensitive domains into STX1B or its interacting partners, researchers can manipulate SNARE complex formation with unprecedented temporal precision, providing insights into the kinetics of STX1B-mediated vesicle fusion.

  • Single-molecule tracking: Advanced microscopy techniques now permit tracking of individual STX1B molecules in living neurons. These approaches reveal the nanoscale organization and dynamics of STX1B at the presynaptic terminal, providing insights into how STX1B clustering relates to active zone organization and function.

  • Genetically encoded sensors for SNARE complex formation: Developing FRET-based sensors that report on STX1B interactions with other SNARE proteins would allow real-time monitoring of SNARE complex assembly in living neurons. Such tools would bridge the gap between static structural studies and functional outcomes of STX1B activity.

  • Cryo-electron tomography: This emerging technique allows visualization of macromolecular complexes in their native cellular environment at near-atomic resolution. Applied to synaptic preparations, it could reveal the three-dimensional organization of STX1B-containing SNARE complexes at the active zone.

These approaches collectively promise to transform our understanding of STX1B from static snapshots to dynamic processes in living systems.

How might STX1B research contribute to understanding neurological disorders?

STX1B research has significant implications for understanding and potentially treating several neurological disorders:

  • Epilepsy: Recent genetic studies have identified STX1B mutations in patients with various forms of epilepsy, including fever-associated epilepsy syndromes and myoclonic epilepsies. The critical role of STX1B in regulating neurotransmitter release suggests that dysfunction of this protein could disrupt the excitatory/inhibitory balance in neural circuits, potentially explaining some forms of epileptogenesis.

  • Neurodevelopmental disorders: Given the early postnatal lethality of STX1B knockout mice, STX1B likely plays essential roles in neurodevelopment . Subtle mutations or expression changes might contribute to neurodevelopmental disorders characterized by synaptic dysfunction, such as autism spectrum disorders or intellectual disabilities.

  • Neurodegenerative diseases: Synaptic dysfunction is an early feature of many neurodegenerative diseases, including Alzheimer's and Parkinson's diseases. Understanding how STX1B-mediated vesicle release is affected in these conditions could provide insights into disease mechanisms and potential therapeutic targets.

  • Movement disorders: The preferential expression of STX1B at motor endplates suggests specific roles in motor control . Dysfunction in these circuits could contribute to movement disorders, making STX1B a potential target for investigation in conditions like dystonia or ataxia.

Research approaches integrating human genetics, animal models, and functional studies of disease-associated STX1B variants will be particularly valuable for translating basic STX1B research into clinical insights. The development of conditional knockout models, allowing for temporal and spatial control of STX1B deletion, will help overcome the challenges posed by the early lethality of conventional STX1B knockouts .

What are the most promising interdisciplinary approaches for advancing STX1B research?

Advancing STX1B research will benefit significantly from interdisciplinary approaches that integrate multiple technologies and perspectives:

  • Integration of structural biology with functional studies: Combining high-resolution structural information about STX1B (from techniques like X-ray crystallography and cryo-EM) with functional studies (electrophysiology, optical imaging) would provide mechanistic insights into how structural features translate to functional properties. This approach could reveal how specific STX1B mutations identified in patients affect protein function.

  • Systems neuroscience perspectives: Moving beyond cellular-level analyses to understand how STX1B functions impact neural circuit dynamics and behavior would provide a more comprehensive view of its physiological significance. This approach might involve circuit-specific conditional knockout models combined with in vivo electrophysiology or calcium imaging.

  • Computational modeling of vesicle release: Developing quantitative models of vesicle release that incorporate STX1B dynamics could help predict how specific alterations in STX1B function affect neurotransmission. These models could guide experimental design and interpretation of complex phenotypes observed in STX1B mutants.

  • Combining proteomics with functional genomics: Large-scale proteomic approaches to identify the complete interactome of STX1B, combined with functional genomic screens to identify genetic modifiers of STX1B function, would provide a systems-level understanding of STX1B biology. This approach could reveal unexpected pathways and interactions influencing STX1B function.

  • Translational research integrating clinical observations: Establishing bidirectional flows of information between basic STX1B research and clinical studies of patients with STX1B mutations would accelerate both basic understanding and clinical applications. This might involve creating patient-specific induced pluripotent stem cell (iPSC) models to study how specific STX1B variants affect human neurons.

These interdisciplinary approaches would collectively advance STX1B research beyond the current state of knowledge, potentially revealing novel therapeutic targets for neurological disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.