Recombinant Mouse T-cell immunomodulatory protein (Itfg1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse T-cell Immunomodulatory Protein (Itfg1)

Integrin Alpha FG-GAP Repeat Containing 1 (ITFG1), also known as LINKIN, is a conserved transmembrane protein crucial for tissue integrity . ITFG1 has been identified as necessary for tissue integrity . Studies indicate its involvement in cell networks related to cell cycle, mitochondrial translation initiation, and the regulation of DNA repair .

ITFG1 and RUVBL1 Interaction

ITFG1 interacts with RUVBL1, an interaction required for breast cancer cell collective invasion and progression . Research confirms the specific interaction between ITFG1 and RUVBL1, validating the immunoprecipitation-mass spectrometry approach .

Expression and Localization of ITFG1

ITFG1 primarily localizes to the plasma membrane in cells, with low endogenous expression levels . When ITFG1 was expressed in cells, it was primarily found in the membrane fraction .

ITFG1 Interacting Proteins

Mass spectrometry analysis has identified proteins that interact with ITFG1 . A study identified 2628 and 1242 proteins with higher enrichment in transient and stable ITFG1-expressing cells, respectively, over control cells . Further analysis revealed 180 proteins shared between ITFG1-expressing cells, suggesting their specific association with ITFG1 .

Immunogenicity of IL-21

IL-21 is a pleiotropic cytokine that can catalyze downstream signaling events and synergize with PD-1/PD-L1 blockade . Combining PD-1 blockade with IL-21 has demonstrated efficacy in mouse tumor models by enhancing CD8 T cell infiltration into the tumor . Nonclinical studies have informed on the risk of immunogenicity in humans due to the IL-21-driven nature of the response .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Itfg1; D8Wsu49e; Lnkn-1; Tip; T-cell immunomodulatory protein; Protein TIP; Integrin-alpha FG-GAP repeat-containing protein 1; Linkin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-610
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Itfg1
Target Protein Sequence
LHNVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQSAPYFKPKVKVSL KTLSALVTSVVPGDYDGDSQMDVLLTYFPQNHTNSELGAVIFWGQNQTLDPKNMTILNRT FHDQPLIMDFNGDLIPDVFGITNESSQPQILLGGDLSWHPALTTKSKMRDPHSHAFIDLT EDFTADLFLTTLTASNAFQFEIWENLGGNFSIHSVFEKPKNLVVVGQSAFADFDGDGHMD HLLPGCEDKDCQKSAIYLMRSGTGQWVPVLQDFSNKGTLWGFVPFVHEEQPTTIPIPLTL HIGDYNMDGYPDALAILKNTSGSNQQAFLLENVPCNNASCEEVHRMFKVYWDLAGLNLIK DAIVATFFDIYEDGILDIIVLSKGYTKNDVAIHTLKNNFEADAYFVKVIVLSGLCSNDCP RKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDH LFVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLYLTPSNIVLLTAVAL IGVCIFILAIIAILHWQEKKADDREKRQEAHRFHFDAM
Uniprot No.

Target Background

Function
Recombinant Mouse T-cell immunomodulatory protein (Itfg1) is a modulator of T-cell function and exhibits a protective effect in graft-versus-host disease models.
Database Links
Protein Families
TIP family
Subcellular Location
Secreted. Membrane; Single-pass type I membrane protein.

Q&A

What is the molecular structure of mouse Itfg1 and how does it compare to human ITFG1?

Mouse Itfg1 is a glycoprotein of approximately 96-100 kDa that contains FG-GAP (phenylalanyl-glycyl-glycyl-alanyl-prolyl) repeats, domains critical for protein-protein interactions. Structurally, it appears to be a type I transmembrane protein with an N-terminal extracellular domain coupled to a C-terminal transmembrane and cytoplasmic region . The mouse protein shares remarkable homology with human ITFG1, with 89% amino acid sequence identity over positions 1-566 . Both proteins contain similar functional domains, including an N-terminal signal peptide and C-terminal transmembrane domain flanking multiple N-linked glycosylation sites .

Table 1: Comparison of Mouse Itfg1 and Human ITFG1

FeatureMouse Itfg1Human ITFG1
Molecular Weight~96-100 kDa~98 kDa
Sequence Homology89% identity with human88% identity with rat
AccessionNot specified in literatureQ8TB96
GlycosylationMultiple sites12 potential N-linked sites
Subcellular LocalizationCell surfaceCell surface

What are the primary functions of Itfg1 in the immune system?

Despite its name suggesting T-cell specificity, Itfg1 functions more broadly as an immunomodulatory protein. When recombinant Itfg1 protein is added to human and mouse T cells in vitro, it stimulates secretion of multiple cytokines including IFN-γ, TNF-α, and IL-10 after CD3/CD28-mediated activation . Significantly, in vivo studies demonstrate that Itfg1 exhibits protective effects in mouse models of acute graft-versus-host disease (GVHD) . This suggests that Itfg1 plays an important immunoregulatory role, potentially by modulating T-cell responses and inflammatory processes.

What is the expression pattern of Itfg1 across tissues?

Itfg1 demonstrates a paradoxical expression pattern. While generally described as ubiquitously expressed across tissues, it is notably absent on T cells, B cells, and monocytes , despite its involvement in T-cell biology. This expression profile suggests that Itfg1 may function through intercellular interactions rather than cell-autonomous mechanisms in immune regulation. Researchers should consider this when designing experiments targeting specific cell populations.

How does Itfg1 influence liver regeneration and what mechanisms are involved?

Recent research has identified Itfg1 as a promising target for enhanced liver regeneration and chronic liver disease treatment . Itfg1 functions as a "regeneration break" in the liver, and its knockdown produces remarkable effects:

  • Accelerated proliferation and wound healing of both mouse and human hepatocytes in vitro

  • Enhanced ability of hepatocytes to repopulate the liver in FAH deficient mice

  • Accelerated liver regeneration upon partial hepatectomy in fully repopulated mice

  • Attenuation of thioacetamide (TAA) and "Western Diet" induced chronic liver damage

These findings suggest that targeting Itfg1 could be a novel therapeutic approach for enhancing endogenous liver regenerative capacity. Researchers established these effects through comprehensive in vivo functional genetic RNAi screening in the TAA-driven chronic liver disease model, where two independent shRNAs targeting Itfg1 were significantly enriched .

What protein-protein interactions does Itfg1 participate in and what is their functional significance?

Itfg1 engages in several important protein interactions that appear crucial for its biological functions. The interaction between Itfg1 and RUVBL1 has been validated in multiple experimental systems including breast cancer cell lines, where it is implicated in cancer metastasis . Through immunoprecipitation and mass spectrometry approaches, researchers have identified approximately 180 potential Itfg1-interacting proteins in MDA-MB-231 breast cancer cells .

Three notable interactors whose C. elegans orthologs produce similar phenotypes to Itfg1 knockdown include:

  • ATP9A/tat-5 (phospholipid translocase)

  • NME1/ndk-1 (nucleoside diphosphate kinase)

  • ANAPC2/apc-2 (E3 ubiquitin ligase component)

Gene ontology analysis of Itfg1-interacting proteins reveals enrichment in multiple cellular networks, including cell cycle regulation, mitochondrial translation initiation, and DNA repair processes , suggesting diverse functional roles.

How does Itfg1 contribute to cell adhesion and migration during development?

Research in C. elegans has established that the Itfg1 ortholog (LNKN-1) is essential for maintaining tissue integrity during collective cell migration . Loss-of-function analysis of LNKN-1 in C. elegans results in migratory detachment phenotypes, indicating that Itfg1 plays a critical role in cell-cell or cell-matrix adhesion during migration . This function appears conserved, as epitope-tagged ITFG1 localizes to the cell surface of human breast cancer cells , consistent with a role in adhesion.

The involvement of Itfg1 in both cell adhesion and immune modulation represents an intriguing connection between these biological processes that warrants further investigation.

What approaches are available for manipulating Itfg1 expression in experimental models?

Researchers have successfully employed several strategies to modulate Itfg1 expression:

  • RNA interference (RNAi): In vivo functional genetic RNAi screens have utilized shRNAs targeting Itfg1, with two independent shRNAs showing significant enrichment in liver disease models .

  • CRISPR/Cas9 gene editing: All-in-One lentivector systems containing sgRNAs targeting Itfg1 are available for gene knockout experiments. These typically include sets of three sgRNA targets designed to create frameshift mutations in exonic regions .

Table 2: Experimental Approaches for Itfg1 Manipulation

ApproachApplicationAdvantagesConsiderations
shRNAKnockdownPartial reduction, reversiblePotential off-target effects
CRISPR/Cas9KnockoutComplete elimination, heritableRequires validation of editing efficiency
Recombinant proteinGain-of-functionDirect modulation of activityMay not reflect physiological levels
Antibody blockingInhibitionTarget specific domainsLimited to accessible epitopes

When designing knockout strategies, researchers should consider targeting early exons to maximize the likelihood of complete functional disruption and carefully validate editing efficiency.

What methods are most reliable for detecting Itfg1 expression and localization?

Several validated approaches for detecting Itfg1 expression and localization have been reported:

  • Flow cytometry: K562 human chronic myelogenous leukemia cell line has been successfully stained with anti-human ITFG1 antibodies (both APC-conjugated and unconjugated followed by secondary detection) . This approach is particularly useful for quantifying cell surface expression.

  • Subcellular fractionation: This technique has confirmed that ITFG1 primarily localizes to the membrane fraction in MDA-MB-231 cells , providing biochemical evidence for its membrane association.

  • Immunostaining: Direct visualization of ITFG1 on the plasma membrane of transfected cells has been achieved through immunofluorescence microscopy .

  • Western blot: Anti-ITFG1 antibodies can detect the protein at the expected molecular weight range (75-100 kDa) .

For optimal results in detecting endogenous Itfg1, which may be expressed at low levels in some cell types, researchers should consider using signal amplification techniques and carefully validated antibodies.

What are the optimal conditions for producing functional recombinant mouse Itfg1?

While specific production protocols for mouse recombinant Itfg1 are not detailed in the provided literature, several considerations can be extrapolated from related research:

  • Expression system: E. coli has been successfully used to produce recombinant human ITFG1 fragments , but for full-length glycosylated protein, eukaryotic expression systems (mammalian, insect) would likely yield more functionally relevant protein.

  • Purification strategy: Recombinant ITFG1 fragments with His-ABP tags have been produced at concentrations of ≥5.0 mg/mL , suggesting affinity purification is effective.

  • Storage conditions: Recombinant ITFG1 antibodies are typically stored at -20°C to -70°C for long-term stability, with limited freeze-thaw cycles recommended .

For functional studies, researchers should confirm that recombinant Itfg1 retains its ability to stimulate cytokine production in T cells, as this provides a reliable functional readout.

How can I validate the specificity of Itfg1 antibodies for immunological applications?

To ensure antibody specificity when working with Itfg1:

  • Blocking experiments: Human ITFG1 control fragment recombinant protein (aa 284-423) has been used for blocking experiments with corresponding antibodies. For optimal blocking, a 100x molar excess of the protein fragment control is recommended, with pre-incubation of the antibody-protein control fragment mixture for 30 minutes at room temperature .

  • Knockout controls: CRISPR/Cas9-mediated knockout cells provide the most stringent negative control for antibody validation.

  • Multiple antibody validation: Using antibodies targeting different epitopes of Itfg1 can provide additional confidence in detection specificity.

  • Cross-species reactivity: While human ITFG1 antibodies might recognize mouse Itfg1 due to high sequence conservation (89% identity), this should be experimentally validated for each specific antibody.

How should researchers interpret Itfg1 knockdown phenotypes across different model systems?

When interpreting Itfg1 knockdown data, several considerations are essential:

  • Cell type specificity: Itfg1 functions appear context-dependent, with distinct roles in hepatocytes, immune cells, and migrating cells . Phenotypic differences between cell types may reflect genuine biological variation rather than experimental inconsistency.

  • Acute versus chronic effects: The temporal dynamics of Itfg1 knockdown should be considered, as compensatory mechanisms may emerge over time.

  • Cross-species conservation: The similar phenotypes observed upon knockdown of Itfg1 orthologs in different species (e.g., migratory detachment in C. elegans and enhanced liver regeneration in mice) suggest evolutionary conservation of function.

  • Interaction network context: Itfg1 functions within a network of protein interactions, and phenotypic effects may depend on the expression of interaction partners in specific experimental systems.

What considerations are important when designing in vivo experiments using recombinant mouse Itfg1?

For in vivo studies with recombinant Itfg1:

  • Dosage determination: Titration experiments should be performed to establish dose-response relationships, as different biological effects might require different concentrations.

  • Route of administration: Given Itfg1's membrane localization and role in cell-cell interactions, local versus systemic administration may yield different outcomes.

  • Half-life and biodistribution: Researchers should determine the pharmacokinetic properties of recombinant Itfg1 to establish appropriate dosing intervals.

  • Functional validation: In vivo administration should be validated by measuring expected biological effects, such as cytokine production or protection in GVHD models .

  • NIH Guidelines compliance: As work with recombinant proteins falls under NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, appropriate institutional approvals should be obtained .

How can findings from mouse Itfg1 studies be translated to human applications?

Translating mouse Itfg1 findings to human applications is supported by several factors:

  • High sequence conservation: The 89% amino acid identity between mouse and human proteins suggests functional conservation .

  • Conserved cellular functions: Both mouse and human Itfg1 demonstrate similar effects in hepatocyte proliferation and T-cell cytokine production .

  • Cross-species validation: Key findings have been validated in both mouse and human experimental systems, such as the enhanced regenerative capacity upon Itfg1 knockdown in both mouse and human hepatocytes .

  • Disease relevance: The protective effects of Itfg1 in mouse GVHD models and its role in liver regeneration suggest potential therapeutic applications that could be developed for human conditions .

What are the most promising therapeutic applications for targeting Itfg1?

Based on current research, several therapeutic applications merit further investigation:

  • Liver regeneration enhancement: Itfg1 inhibition represents a promising strategy for enhancing endogenous liver regenerative capacity in patients with chronic liver disease .

  • GVHD prevention: The protective effects of Itfg1 in mouse GVHD models suggest potential applications in mitigating complications of hematopoietic stem cell transplantation .

  • Cancer metastasis: The interaction between Itfg1 and RUVBL1 and its implication in breast cancer metastasis suggests Itfg1 as a potential target for anti-metastatic therapies .

What technical advances would facilitate more comprehensive studies of Itfg1 function?

Several technological developments would advance Itfg1 research:

  • Domain-specific antibodies: Development of antibodies targeting specific functional domains of Itfg1 would enable more precise inhibition studies.

  • Tissue-specific conditional knockout models: These would allow temporal and spatial control of Itfg1 deletion to dissect its role in specific physiological contexts.

  • Structure-function analysis: Determination of the three-dimensional structure of Itfg1 would facilitate rational design of inhibitors or mimetics.

  • Systems biology approaches: Integration of proteomics, transcriptomics, and metabolomics data would provide a more comprehensive understanding of Itfg1's role in cellular networks.

What aspects of Itfg1 biology remain poorly understood?

Despite significant advances, several knowledge gaps remain:

  • Transcriptional regulation: The mechanisms controlling Itfg1 expression in different tissues and disease states are not well characterized.

  • Post-translational modifications: The functional impact of glycosylation and other potential modifications on Itfg1 activity requires further investigation.

  • Signaling pathways: The downstream signaling events triggered by Itfg1 engagement remain to be fully elucidated.

  • Developmental roles: The function of Itfg1 during embryonic and postnatal development has not been comprehensively studied.

  • Evolutionary conservation: While structural conservation is established, functional conservation across diverse species requires further validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.