Recombinant Mouse T-cell surface antigen CD2 (Cd2)

Shipped with Ice Packs
In Stock

Description

Definition and Structure of Recombinant Mouse T-Cell Surface Antigen CD2 (Cd2)

Recombinant Mouse CD2 is a genetically engineered protein corresponding to the extracellular and intracellular domains of the murine CD2 molecule. It is produced via heterologous expression systems, such as HEK293 cells, and purified to high homogeneity (>98% purity) . CD2 belongs to the immunoglobulin superfamily and functions as a key adhesion and costimulatory molecule in T-cell activation.

Biological Functions of CD2

CD2 modulates T-cell activation through adhesion, signaling, and cytoskeletal reorganization.

Role in T-Cell Activation and Adhesion

CD2 facilitates antigen-presenting cell (APC)-T cell conjugation by:

  • Enhancing Membrane Proximity: CD2-CD48/CD58 interactions position TCR/pMHC complexes at optimal distances (~14 nm) for signaling .

  • Setting Thresholds for Activation: CD2-deficient T cells require 3–10-fold higher antigen doses to activate, particularly for low-affinity TCR ligands .

  • Additive Effects with LFA-1/ICAM-1: Combined absence of CD2-CD48 and LFA-1-ICAM-1 interactions reduces T-cell activation by ~100-fold .

Intracellular Signaling and Cytoskeletal Dynamics

  • Lipid Raft Translocation: Upon activation, CD2 partitions into lipid rafts, co-localizing with src kinases (Lck, Fyn) and LAT, driving TCR/CD3 signaling .

  • Actin Cytoskeleton Regulation: CD2 interacts with actin-binding proteins outside lipid rafts, influencing cell motility and IS formation .

Quantitative Thresholds in Activation

Experimental ModelObservationSource
CD2-Deficient MiceReduced proliferation and IFN-γ production at low antigen doses ,
High-Affinity TCRsMinimal reliance on CD2 for activation (e.g., LCMV p33-specific T cells)
Cross-PrimingImpaired responses in CD2-deficient T cells to suboptimal antigen presentation

Applications in Research and Immunology

  1. Functional Studies: Recombinant CD2 is used to study adhesion, signaling, and IS dynamics in vitro.

  2. Therapeutic Targeting: Anti-CD2 antibodies modulate T-cell responses (e.g., sustained hyporesponsiveness post-administration) .

  3. Vaccine Development: Insights into CD2’s role in cross-priming guide strategies for antigen delivery and immune memory.

References and Key Publications

  1. CD2 Immunobiology: Comprehensive review on CD2’s role in IS formation and actin dynamics .

  2. Quantitative Thresholds: Bachmann et al. demonstrated CD2’s additive role with LFA-1 in T-cell activation .

  3. Structural Insights: Crystallographic studies of CD2-CD58 complexes revealed head-to-head binding critical for membrane positioning .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for precise delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cd2; Ly-37; T-cell surface antigen CD2; LFA-2; LFA-3 receptor; Lymphocyte antigen 37; T-cell surface antigen T11/Leu-5; CD antigen CD2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-344
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Cd2
Target Protein Sequence
RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLSFYVTVGVGAGGLLLVLLVALFIFCICKRRKRNRRRKDEELEIKASRTSTVERGPKPHSTPAAAAQNSVALQAPPPPGHHLQTPGHRPLPPGHRTREHQQKKRPPPSGTQIHQQKGPPLPRPRVQPKPPCGSGDGVSLPPPN
Uniprot No.

Target Background

Function
CD2 interacts with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1 to facilitate adhesion between T-cells and other cell types. CD2 is implicated in T-cell activation, and its cytoplasmic domain plays a role in signaling function.
Gene References Into Functions
  1. Ptpn22 and Cd2 Variations Are Associated with Altered Protein Expression and Susceptibility to Type 1 Diabetes PMID: 26438525
  2. CD2 stimuli are crucial for Treg cell survival with reduced Bim expression, but CD2 may not act as a direct receptor for molecules on stromal cells. PMID: 23278598
  3. CD2 is vital for the efficient development of CD4 single-positive thymocytes and TCR-dependent activation of mature CD4 lymph node T cells, but does not dictate a specific helper T cell subset polarity. PMID: 11801645
  4. This antigen is a major target for heart allograft responses. PMID: 12201362
  5. molecular mechanism of heterophilic adhesion between the murine T-cell adhesion glycoprotein CD2 and its ligand CD48 PMID: 12356317
  6. Despite normal T cell counts, mice lacking the costimulatory molecules CD2 and CD28 spontaneously develop Pneumocystis carinii pneumonia. PMID: 12902500
  7. autoimmunity may be triggered by a combination of genes in the SLAM/CD2 family cluster PMID: 15589166
  8. Analysis of the ligand-receptor pairs involved in the induction of germline transcripts (Igamma2a) necessary for switch recombination revealed that expression of CD48 on B cells and ligands CD2 and CD244 on NK cells are capable of stimulating Igamma2a PMID: 15778370
  9. CD2 deficient mice exhibit increased resistance to T. gondii infection compared to wild-type mice PMID: 17696249
  10. nanoscale increases in CD2-CD48-mediated intermembrane spacing reduce adhesion and reorganize the immunological synapse PMID: 18826951
  11. CD244 inhibition and activation is dependent on CD2 and phospholipase C-gamma1 PMID: 19586919

Show More

Hide All

Database Links
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Detected in thymus and spleen.

Q&A

What is the basic function of CD2 in the immune system?

CD2 is one of the earliest T cell markers identified and plays multiple roles in immune function. It serves as both an adhesion molecule and a costimulatory receptor on T cells. The primary functions include facilitating cell-cell contact between T cells and antigen-presenting cells (APCs), optimizing immune recognition by juxtaposing surface membranes at a distance suitable for T cell receptor-ligand interaction, and providing costimulatory signals that enhance T cell activation . Additionally, CD2 contributes to T cell polarization and scanning behavior during immune surveillance .

How does CD2 expression vary across T cell populations?

CD2 expression levels vary significantly across different T cell populations and activation states. Notably, exhausted CD8+ T cells in tumor microenvironments show reduced surface CD2 levels compared to functional T cells . This is particularly evident in exhausted CD127lowPD-1hi CD3+CD8+ tumor infiltrating lymphocytes (TILs) in colorectal cancers. Transcriptional profiling reveals a negative correlation between CD2 expression and "exhausted CD8+ T-cells" gene signatures . This expression pattern appears to be independent of microsatellite instability status, suggesting CD2 downregulation is a feature of T cell exhaustion rather than a consequence of tumor genetics .

What role does CD2 play in T cell development in mouse models?

Despite CD2's early expression during thymic development, studies with CD2-deficient mouse models have yielded surprising results. Homozygous CD2 knockout mice develop healthy lymphocyte populations and can mount effective immune responses similar to wild-type controls . Thymocyte selection processes, including those involving MHC class I- or class II-restricted transgenic T cell receptors, appear grossly normal in the absence of CD2 . These findings suggest that while CD2 is expressed early in thymocyte ontogeny, it may be functionally redundant or dispensable for T cell development in mice, possibly due to compensatory mechanisms .

How does CD2 signaling intensity correlate with T cell activation outcomes?

CD2 functions as a positive regulator of TCR signaling intensity, particularly during primary T cell-mediated immune responses. The effect of CD2 on T cell activation is dependent on TCR signal strength . T cells expressing high-affinity TCRs are less reliant on CD2 signaling to mount a full immune response, while CD2 becomes crucial for cells expressing TCRs that bind antigens with lower affinity . This suggests CD2 may serve as a signal amplifier that becomes increasingly important as TCR signaling strength decreases, allowing for responses to weaker TCR agonists that might otherwise fail to activate T cells .

What experimental approaches can be used to study CD2 redistribution during T cell scanning?

To investigate CD2 redistribution during T cell scanning, researchers can employ time-lapse video microscopy and image analysis techniques . The experimental setup typically involves:

  • Labeling CD2 molecules with fluorescent antibodies or generating fluorescent protein-tagged CD2 constructs

  • Creating a cellular substratum of antigen-presenting cells expressing CD58 (human) or equivalent ligands

  • Using digitized time-lapse differential interference contrast and immunofluorescence microscopy on living cells

  • Quantifying the density of CD2 molecules in different regions of the T cell (uropod versus leading edge)

  • Employing antibody blocking of CD2-CD58 interactions or CD58 mutants with altered binding activity to assess functional requirements

This approach has revealed that surface CD2 molecules rapidly redistribute upon interaction with cellular substrata, resulting in approximately 100-fold greater CD2 density in the uropod compared to the leading edge of scanning T cells .

How can researchers experimentally differentiate between CD2-dependent and integrin-dependent aspects of T cell scanning?

To differentiate between CD2-dependent and integrin-dependent aspects of T cell scanning, researchers can design experiments with the following components:

  • Generate comparative analyses using antibody blockade of CD2-CD58 interactions versus CD11a/CD18 (LFA-1) integrin interactions

  • Utilize CD58 mutants with specifically reduced CD2 binding activity (e.g., K34A and K87A mutations) as negative controls, alongside mutations outside the CD2 binding site (E76A and K50A) as positive controls

  • Measure distinct parameters of scanning behavior, including percentage of scanning T cells, scanning velocity, and cellular polarization

  • Combine with inhibitors of myosin light chain kinase to assess cytoskeletal requirements

  • Analyze redistribution patterns of different surface molecules (CD2 vs. CD11a/CD18 vs. CD45) during scanning

Such approaches have demonstrated that CD2 and CD11a/CD18 play non-redundant roles in T cell adhesion, migration, and immune activation .

What are the optimal experimental designs for studying CD2 function in knockout versus wild-type mice?

When designing experiments to study CD2 function using knockout versus wild-type mice, researchers should consider the following methodological approaches:

  • Experimental design: Implement a between-subjects design comparing CD2-deficient mice to wild-type controls, with appropriate sample sizes determined through power analysis .

  • Variables to measure:

    • Primary immune responses to various antigens

    • T cell development markers in thymus and periphery

    • Cytotoxic T cell generation and function

    • Antibody production following immunization

    • Selection of thymocytes expressing MHC-restricted transgenic TCRs

  • Additional controls: Include heterozygous mice to detect potential gene dosage effects and use littermate controls to minimize genetic background variations.

  • Challenge conditions: Test immune responses under both optimal and suboptimal conditions, as CD2 deficiency effects may only become apparent when the immune system is challenged with weak antigens or limited stimulation .

  • Analysis approach: Employ multivariate analysis to detect subtle phenotypic differences across multiple parameters that might not be apparent in univariate analyses .

This comprehensive approach has revealed that CD2-deficient mice mount effective immune responses comparable to wild-type controls across multiple parameters, suggesting compensatory mechanisms may exist in constitutive knockout models .

What methods can be used to quantitatively assess CD2 expression levels and correlate them with T cell function?

To quantitatively assess CD2 expression levels and correlate them with T cell function, researchers can employ these methodological approaches:

  • Flow cytometry:

    • Measure surface CD2 expression on different T cell subsets

    • Correlate with functional markers (activation markers, exhaustion markers like PD-1)

    • Use multi-parameter analysis to identify correlations between CD2 expression and various functional states

  • Transcriptional profiling:

    • Analyze CD2 mRNA expression alongside gene signatures for T cell states

    • Perform linear regression analysis to identify correlations between CD2 expression and exhaustion signatures

    • Validate findings across independent cohorts

  • Functional assays:

    • Sort T cells based on CD2 expression levels and assess:

      • Proliferation capacity

      • Cytokine production (particularly IFN-γ)

      • Cytotoxic activity

      • Response to weak versus strong TCR agonists

  • Imaging analysis:

    • Quantify CD2 distribution in the immunological synapse at different expression levels

    • Correlate CD2 expression with corolla formation and recruitment of signaling molecules like pSrc, LAT, and PLC-γ

These methods have revealed that CD2 expression acts as a quantitative checkpoint for immunological synapse organization and T cell activation, with expression levels correlating linearly with synapse architecture and signaling capacity .

How does CD2 expression level influence immunological synapse formation and T cell signaling?

CD2 expression levels exert a dose-dependent effect on immunological synapse (IS) formation and T cell signaling. Research has identified a CD2 expression-level-dependent switch in CD2-CD58 localization between central and peripheral domains in the IS . When CD2 surface expression reaches a sufficient threshold and its cytoplasmic domain is intact, a peripheral "CD2 corolla" forms around the central synapse. This corolla structure:

  • Recruits other ligated receptors including CD28

  • Boosts recruitment of activated Src-family kinases (pSrc)

  • Enhances LAT and PLC-γ localization in the IS

  • Consequently amplifies T-cell activation in response to tumor antigens

What are the molecular mechanisms explaining the discrepancy between in vitro CD2 importance and in vivo CD2 knockout phenotypes?

The apparent discrepancy between the importance of CD2 in in vitro studies and the mild phenotype of CD2 knockout mice can be explained by several molecular mechanisms:

This multifaceted explanation highlights the complexity of receptor-ligand interactions in T cell biology and underscores the importance of examining CD2 function across diverse experimental contexts.

How can researchers reconcile the apparent paradox between CD2's role in T cell scanning and findings from CD2-deficient mouse models?

Reconciling the apparent paradox between CD2's documented role in T cell scanning and the relatively normal immune function in CD2-deficient mice requires consideration of several experimental and biological factors:

  • Methodological considerations:

    • Direct observation of CD2 redistribution during scanning uses short-term assays with labeled antibodies or fusion proteins

    • Knockout studies assess long-term, integrated immune responses that may mask subtle deficiencies

    • Different experimental readouts (microscopic cellular behavior versus organism-level immune responses) may not directly correlate

  • Functional redundancy:

    • Multiple adhesion pathways contribute to T cell scanning, including integrins that may compensate for CD2 deficiency in vivo

    • The pre-synapse formation facilitated by CD2 may be achieved through alternative mechanisms in CD2-deficient mice

  • Quantitative effects:

    • CD2-facilitated scanning increases efficiency rather than enabling an otherwise impossible function

    • The 100-fold enrichment of CD2 in the uropod optimizes but is not absolutely required for immune surveillance

    • In the absence of CD2, T cells may still scan APCs, albeit less efficiently

  • Experimental design to resolve the paradox:

    • Assess scanning behavior in T cells from CD2-deficient mice using in vitro and in vivo imaging techniques

    • Challenge CD2-deficient mice with limiting antigen doses or in competitive settings where scanning efficiency becomes critical

    • Employ acute CD2 blockade approaches to bypass developmental compensation

This multi-faceted approach can help researchers understand how T cells maintain adequate immune surveillance in the absence of CD2 while explaining the evolutionary conservation of this apparently non-essential molecule.

What experimental approaches can distinguish between adhesion and signaling functions of CD2 in T cell biology?

To experimentally distinguish between the adhesion and signaling functions of CD2 in T cell biology, researchers can implement these methodological approaches:

  • Domain-specific mutants:

    • Generate recombinant CD2 molecules with mutations in the cytoplasmic signaling domain while preserving extracellular adhesion capability

    • Create mutants that maintain signaling capacity but have altered binding affinity to CD58/CD48

  • Chimeric molecules:

    • Design CD2 chimeras with extracellular domains from CD2 and cytoplasmic domains from other receptors (or vice versa)

    • Assess adhesion versus signaling contributions to T cell function using these chimeras

  • Temporal manipulation:

    • Use rapid and reversible blockade of CD2 at different stages of T cell-APC interaction

    • Compare immediate effects (likely adhesion-dependent) versus delayed effects (potentially signaling-dependent)

  • Cytoskeletal inhibitors:

    • Selectively inhibit cytoskeletal rearrangement pathways downstream of CD2

    • Assess which CD2 functions are preserved or disrupted when the cytoskeleton is immobilized

  • Quantitative analysis:

    • Correlate CD2 expression levels with both adhesion strength and signaling intensity

    • Determine whether adhesion and signaling functions have different CD2 expression thresholds

These approaches can help distinguish the dual functions of CD2 and determine their relative importance in different contexts of T cell biology.

How can transcriptional profiling be optimally designed to study CD2-associated exhaustion signatures in tumors?

To optimally design transcriptional profiling studies investigating CD2-associated exhaustion signatures in tumors, researchers should consider these methodological approaches:

  • Study design considerations:

    • Use paired tumor and adjacent normal tissue samples to control for individual variation

    • Include samples spanning various levels of T cell infiltration and activation states

    • Ensure adequate representation of microsatellite stable and instable tumors to control for this variable

  • Single-cell versus bulk analysis:

    • Employ single-cell RNA sequencing to distinguish cell type-specific CD2 expression patterns

    • Combine with protein-level analysis (CyTOF or multi-parameter flow cytometry) to correlate transcriptional signatures with surface CD2 expression

  • Signature development and validation:

    • Develop CD2-associated gene signatures using training cohorts

    • Validate signatures across independent patient cohorts

    • Perform linear regression analysis to quantify correlations between CD2 expression and exhaustion signatures

  • Functional validation:

    • Sort T cells based on CD2 expression levels and perform functional assays

    • Correlate transcriptional profiles with functional readouts

    • Manipulate CD2 expression to determine causality versus correlation

This approach has successfully identified negative correlations between CD2 expression and exhausted T-cell signatures in colorectal cancers, providing insights into molecular mechanisms of T cell dysfunction in tumors .

What control conditions are essential when using anti-CD2 antibodies to study CD2 function in vitro?

When using anti-CD2 antibodies to study CD2 function in vitro, researchers should implement these essential control conditions:

  • Antibody specificity controls:

    • Use isotype-matched control antibodies to rule out Fc receptor-mediated effects

    • Include CD2-deficient cells to confirm antibody specificity

    • Use F(ab) or F(ab')2 fragments to eliminate Fc receptor engagement when possible

  • Functional readout controls:

    • Compare anti-CD2 effects with known activating (anti-CD3/CD28) and inhibitory antibodies

    • Include dose-response curves to identify potential biphasic effects of CD2 engagement

    • Test effects on multiple T cell subsets, as responses may differ between naïve and memory populations

  • Temporal controls:

    • Assess both immediate and long-term effects of CD2 targeting

    • Note that single-dose anti-CD2 monoclonal antibody treatment can induce sustained T cell hyporesponsiveness for up to 4 weeks

  • Combination controls:

    • Test anti-CD2 antibodies in combination with other stimuli of varying strength

    • CD2 effects are more pronounced with weak TCR signals, so include strong and weak TCR agonists in parallel experiments

These controls help distinguish specific CD2-mediated effects from non-specific antibody effects and provide context for interpreting experimental results.

What are the key variables to control when comparing CD2 distribution in different T cell activation states?

When comparing CD2 distribution across different T cell activation states, researchers should control these key variables:

  • Cell fixation and permeabilization:

    • Use consistent fixation protocols as these can affect membrane protein distribution

    • Control fixation timing precisely, as redistribution of CD2 happens rapidly during cellular interactions

    • Validate findings with complementary techniques (live cell imaging, biochemical fractionation)

  • Imaging parameters:

    • Maintain consistent imaging settings between samples (exposure time, gain, resolution)

    • Use internal controls for fluorescence intensity calibration

    • Analyze multiple cells (>30 per condition) to account for cell-to-cell variability

  • Temporal considerations:

    • CD2 redistribution is a dynamic process; standardize the time points for analysis

    • Compare distribution at multiple time points following stimulation

    • Consider both early polarization (minutes) and sustained redistribution (hours)

  • Co-staining controls:

    • Include markers for cellular polarization (front vs. rear)

    • Co-stain for other molecules like CD11a/CD18 and CD45 as internal controls

    • Use lipid raft markers to correlate CD2 distribution with membrane microdomains

  • Quantification methodology:

    • Define clear criteria for measuring CD2 distribution (intensity ratios, clustering algorithms)

    • Use automated image analysis to reduce observer bias

    • Report fold-enrichment values rather than absolute measures to normalize for expression level differences

These controlled approaches ensure reliable comparison of CD2 distribution patterns across different experimental conditions and activation states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.