Recombinant Mouse T-cell surface glycoprotein CD3 delta chain (Cd3d)

Shipped with Ice Packs
In Stock

Description

Production and Validation

Recombinant CD3D is often co-expressed with CD3E to form functional heterodimers, mimicking native TCR-CD3 complexes.

Key Production Metrics:

  • Purity: >90% (SDS-PAGE) .

  • Endotoxin Levels: <1.0 EU/μg .

  • Bioactivity: Validated via binding assays (e.g., ELISA with anti-CD3ε antibodies) .

Heterodimer Examples:

  • CD3D/CD3E (Mouse):

    • Expressed in HEK293 or human cells .

    • Molecular weight: 29.2 kDa (calculated), 20–22 kDa (observed under reducing SDS-PAGE due to glycosylation) .

Functional Roles in Immune Signaling

CD3D contributes to TCR complex assembly, surface expression, and signal transduction:

  • ITAM Domains: Contains one immunoreceptor tyrosine-based activation motif (ITAM), critical for downstream signaling .

  • Interactions: Binds CD8A and CD4, linking TCR engagement to co-receptor signaling .

  • Thymocyte Development: Knockout studies in mice show impaired T-cell differentiation, though peripheral TCRγδ+ T cells persist. In humans, CD3D mutations cause severe combined immunodeficiency (SCID) with absent mature T cells .

4.1. Immunotherapy Development

  • Cancer: CD3D-based proteins are used to study T-cell activation in checkpoint inhibitor therapies .

  • Autoimmunity: Models explore TCR-CD3 dysregulation in diseases like multiple sclerosis .

4.3. Disease Modeling

  • SCID Research: Mutant CD3D proteins replicate human immunodeficiency phenotypes .

Challenges and Considerations

  • Glycosylation Variability: HEK293-derived proteins exhibit mammalian glycosylation, whereas E. coli-expressed versions lack it, impacting functional studies .

  • Storage: Lyophilized proteins are stable at -80°C for 12 months but require strict reconstitution protocols .

Future Directions

Current research focuses on:

  • Gene Therapy: Delivering functional CD3D to SCID patients .

  • Bispecific Antibodies: Leveraging CD3D to engage T cells in tumor microenvironments .

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific requirements for the format, please indicate your requirement when placing the order, and we will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance and additional fees will be applied.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
Cd3d; T3d; T-cell surface glycoprotein CD3 delta chain; T-cell receptor T3 delta chain; CD antigen CD3d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-173
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIATLLLALGVYCFAGHETGRPSGAAEVQALLKNEQLYQPLRDREDTQYSRLGGNWPRNKKS
Uniprot No.

Target Background

Function
The CD3 delta chain (Cd3d) is a component of the TCR-CD3 complex found on the surface of T-lymphocytes, playing a crucial role in the adaptive immune response. Upon activation of the T-cell receptor (TCR) by antigen-presenting cells (APCs), TCR-mediated signals are transmitted through the cell membrane by the CD3 chains CD3D, CD3E, CD3G, and CD3Z. Each CD3 chain contains immunoreceptor tyrosine-based activation motifs (ITAMs) within its cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, initiating the activation of downstream signaling pathways. Beyond its role in signal transduction during T-cell activation, CD3D is essential for thymocyte differentiation. It participates in the correct assembly and surface expression of the intracellular TCR-CD3 complex. In the absence of a functional TCR-CD3 complex, thymocytes cannot differentiate properly. CD3D interacts with CD4 and CD8, establishing a functional link between the TCR and coreceptors CD4 and CD8, which is vital for the activation and positive selection of CD4 or CD8 T-cells.
Gene References Into Functions
  1. Mutation of Cd3d not only impairs the proper development of amacrine cells expressing Cd3d but also those not expressing Cd3d . In contrast to the effects of Major histocompatibility complex and its receptor, PirB, on other neurons, mutation of Cd3d has no effect on retinal ganglion cells death and starburst amacrine cells degeneration after optic nerve crush. PMID: 28441398
  2. Polymorphisms of the CD3delta ectodomain exist in mice, some of which lead to amino acid substitutions that cause structural changes and affect anti-CD3 antibody binding. PMID: 20638133
  3. Mouse CD3delta exhibits a T-cell specific expression pattern. PMID: 12324448
  4. There is one molecule each of CD3delta and CD3gamma in the surface TCR/CD3 complex. PMID: 15459203
  5. A human CD3 transgene encoding full-length CD3delta and a truncated but functional form of CD3epsilon restored the defective preTCR function in not only CD3epsilon- but CD3gamma- and CD3gammadelta-deficient mice. PMID: 16412509
  6. CD3delta and CD3gamma play distinct roles in humans and mice during pre-TCR and TCR function in alphabeta T-cell development. PMID: 16888097
  7. CD3delta transgene rescues gammadelta T cell development in mice lacking both mouse CD3delta and CD3gamma. PMID: 17923503
  8. CD3gammaepsilon dimers predominate over CD3deltaepsilon dimers at the early stage of T cell development. PMID: 19819020

Show More

Hide All

Database Links

KEGG: mmu:12500

STRING: 10090.ENSMUSP00000034602

UniGene: Mm.4527

Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is the structure and function of mouse Cd3d?

Mouse T-cell surface glycoprotein CD3 delta chain (Cd3d) is a single-pass type I membrane protein that forms part of the T-cell receptor (TCR)-CD3 complex. Structurally, Cd3d associates with CD3 epsilon to form deltaepsilon dimers within the receptor complex. The complete TCR complex in mice consists of polymorphic TCR alpha and beta chains (or gamma and delta chains) along with invariant CD3 gamma, delta, epsilon, and zeta chains .

Functionally, Cd3d participates in:

  • Signal transduction following antigen recognition

  • TCR complex assembly and stability

  • Transport of the receptor complex to the cell surface

  • T-cell development and maturation

The mouse Cd3d contains one immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain, which is crucial for downstream signaling cascades after T-cell activation .

How does mouse Cd3d differ from human CD3D?

While mouse Cd3d and human CD3D share fundamental functions in T-cell biology, they exhibit several structural and functional differences:

FeatureMouse Cd3dHuman CD3D
Sequence homologyReference sequenceApproximately 70-80% similarity
ITAM structureContains 1 ITAM domainContains 1 ITAM domain
Knockout phenotypeSome T-cell development permittedMore severe developmental defects
Antibody cross-reactivitySpecies-specificSpecies-specific
Signaling partnersInteracts with mouse CD8AInteracts with human CD8A

These differences are particularly important when designing experiments using humanized mouse models, as the species-specific interactions can affect results and interpretations .

What are the recommended methods for producing recombinant mouse Cd3d?

Production of recombinant mouse Cd3d for research applications typically involves:

  • Expression system selection: Mammalian expression systems (HEK293 or CHO cells) are preferred for proper post-translational modifications and folding of Cd3d.

  • Vector design: The gene encoding mouse Cd3d should be codon-optimized for the chosen expression system and include appropriate tags (e.g., His-tag, Fc-tag) for purification.

  • Protein purification: A multi-step purification process involving:

    • Affinity chromatography (using the engineered tag)

    • Size exclusion chromatography

    • Ion-exchange chromatography

  • Quality control: Validation through:

    • SDS-PAGE for purity assessment

    • Western blotting for identity confirmation

    • Functional assays to verify biological activity

  • Storage: Purified recombinant Cd3d should be stored in buffer conditions that maintain protein stability, typically at -80°C with appropriate protease inhibitors .

How can I verify the functional activity of recombinant mouse Cd3d?

Functional verification of recombinant mouse Cd3d requires multiple complementary approaches:

  • Binding assays: Assess binding to natural partners (CD3ε) using techniques such as surface plasmon resonance (SPR) or bio-layer interferometry (BLI).

  • Cell-based functional assays:

    • T-cell activation assays measuring calcium flux

    • Cytokine production assays (e.g., IL-2, IFN-γ)

    • Proliferation assays using CFSE dilution or BrdU incorporation

  • Complex formation analysis:

    • Co-immunoprecipitation with other CD3 components

    • Native PAGE to detect intact complex formation

  • Structural integrity assessment:

    • Circular dichroism to analyze secondary structure

    • Thermal shift assays to evaluate protein stability

Results from these assays should be compared with positive controls (e.g., commercially available validated Cd3d) to ensure the recombinant protein exhibits physiologically relevant activity .

What experimental considerations are important when using humanized CD3D models?

When working with humanized CD3D mouse models, researchers should account for several critical factors:

  • Complete versus partial humanization: Studies show that replacing the entire CD3 complex (CD3E, CD3D, and CD3G, referred to as CD3 EDG) produces more physiologically relevant results than single-component humanization. This approach prevents unnatural combinations of human and mouse components that could affect T-cell development and function .

  • Expression level control: The expression levels of humanized CD3D must be carefully monitored as they can affect:

    • T-cell development kinetics

    • TCR-CD3 complex formation efficiency

    • Signal transduction sensitivity

  • Background strain considerations: The genetic background of mice can influence the phenotype of CD3D humanization. The most extensively characterized model uses C57BL/6N background .

  • Validation protocols: Researchers should validate humanized models through:

    • Flow cytometry to confirm surface expression patterns

    • Functional assays to verify response to human CD3-specific antibodies

    • T-cell development analysis across thymic and peripheral compartments

  • Control groups: Experiments should include:

    • Wild-type mice (responding to mouse Cd3d-specific antibodies)

    • Complete CD3 EDG humanized mice (responding to human CD3D-specific antibodies)

    • Cd3 knockout mice as negative controls

How can mouse Cd3d be utilized in cancer immunotherapy research?

Mouse Cd3d plays a crucial role in cancer immunotherapy research, particularly in developing and evaluating T-cell-based therapeutic approaches:

What are the current challenges in interpreting Cd3d knockout phenotypes?

Interpreting Cd3d knockout phenotypes presents several challenges requiring sophisticated experimental approaches:

  • Partial T-cell development: Unlike complete blockade of T-cell development seen with some CD3 component knockouts, Cd3d knockout mice exhibit partial T-cell development with mature CD4 and CD8 T cells in the periphery. This partial phenotype complicates interpretation of Cd3d's specific role .

  • Compensation mechanisms: Other CD3 components may partially compensate for Cd3d loss, obscuring its unique functions. Researchers should:

    • Analyze expression levels of remaining CD3 components

    • Examine alternative complex formations

    • Assess signaling pathway activation thresholds

  • Strain-dependent variations: Knockout phenotypes can vary based on genetic background. Comprehensive phenotyping should include:

    • T-cell subset distribution analysis

    • TCR signaling strength measurements

    • In vivo immune challenge responses

  • Developmental versus functional defects: Distinguishing between:

    • Developmental defects (thymic selection issues)

    • Functional defects (impaired peripheral activation)

This requires stage-specific and inducible knockout models rather than conventional constitutive knockouts .

How do post-translational modifications affect mouse Cd3d function?

Post-translational modifications (PTMs) of mouse Cd3d significantly influence its functional properties in ways that are crucial for researchers to consider:

  • Glycosylation patterns: Cd3d contains N-linked glycosylation sites that affect:

    • Protein folding and stability

    • TCR complex assembly efficiency

    • Cell surface expression levels

    • Interactions with binding partners

Researchers should analyze glycosylation patterns using:

  • Lectin blotting

  • Mass spectrometry

  • Enzymatic deglycosylation assays

  • Phosphorylation dynamics: The ITAM domain of Cd3d contains tyrosine residues that undergo phosphorylation following TCR engagement, initiating downstream signaling cascades. Analysis requires:

    • Phospho-specific antibodies

    • Phosphoproteomic approaches

    • Site-directed mutagenesis of key residues

  • Ubiquitination and degradation: Cd3d undergoes ubiquitin-mediated regulation affecting:

    • Protein turnover rates

    • Endocytic trafficking

    • TCR complex downregulation

  • Impact on experimental design: When producing recombinant Cd3d, researchers must consider:

    • Expression system selection based on required PTMs

    • Validation of PTM presence and patterns

    • Functional consequences of missing or altered PTMs

What are the optimal approaches for studying Cd3d-mediated signaling pathways?

Investigating Cd3d-mediated signaling pathways requires sophisticated techniques to capture the complex signaling dynamics:

  • Phosphorylation cascade analysis:

    • Phospho-flow cytometry for single-cell resolution

    • Western blotting with phospho-specific antibodies

    • Mass spectrometry-based phosphoproteomics

  • Real-time signaling visualization:

    • FRET-based biosensors for kinase activities

    • Calcium imaging using fluorescent indicators

    • Live-cell imaging of signaling component recruitment

  • Pathway dissection strategies:

    • Pharmacological inhibitors at specific nodes

    • CRISPR/Cas9-mediated genetic modification

    • Inducible expression systems for temporal control

  • Integrated multi-omics approaches:

    • Combining transcriptomics, proteomics, and metabolomics

    • Network analysis to identify signaling hubs

    • Correlation with functional outcomes

  • Single-cell analysis technologies:

    • scRNA-seq to capture heterogeneity in responses

    • CyTOF for high-dimensional protein profiling

    • Spatial transcriptomics to preserve tissue context

These approaches should be applied in both stimulated and basal conditions to fully characterize Cd3d's contribution to T-cell signaling networks .

How can engineered mouse models with modified Cd3d advance immunotherapy research?

Engineered mouse models with modified Cd3d offer powerful platforms for developing next-generation immunotherapies:

  • Humanized CD3 complex models: Complete replacement of mouse Cd3 complex (CD3ε, CD3δ, and CD3γ) with human counterparts enables:

    • Evaluation of human CD3-targeting therapeutic antibodies

    • Testing of bispecific antibodies that simultaneously bind human CD3 and tumor-associated antigens

    • Assessment of immunotherapy efficacy in an immune-competent environment

  • Reporter systems: Knock-in fluorescent reporters linked to Cd3d activation provide:

    • Real-time visualization of T-cell activation in vivo

    • Spatial and temporal mapping of T-cell responses

    • Quantitative assessment of therapeutic intervention effects

  • Conditional expression models: Inducible Cd3d expression systems allow:

    • Temporal control of T-cell activation

    • Lineage-specific manipulation of Cd3d function

    • Reversible modulation of immune responses

  • Modified ITAM domain variants: Models with altered Cd3d signaling capacity through ITAM mutations facilitate:

    • Dissection of signaling thresholds in immunotherapy responses

    • Investigation of partial T-cell activation states

    • Development of approaches to fine-tune T-cell activation

What are the implications of CD3D expression as a prognostic biomarker in cancer?

Recent research has identified significant implications of CD3D expression as a prognostic biomarker in cancer, particularly in head and neck squamous cell carcinoma (HNSCC):

CohortHazard RatioP-valueAUC (5-year survival)
TCGA0.7300.0420.577
GEO0.4990.0010.653
Validation0.5360.0080.653
  • Immune infiltration association: CD3D expression positively correlates with:

    • Increased infiltration of immune effector cells (B cells, CD8+ T cells, CD4+ T cells)

    • Higher ImmuneScore, StromalScore, and ESTIMATEScore

    • Enhanced immune-related functions

  • Predictive value for immunotherapy: Patients with high CD3D expression show:

    • Reduced TIDE scores, suggesting better immunotherapy response

    • Increased expression of HLA-related genes

    • Upregulation of immune checkpoint inhibitor-related genes

    • Higher immunophenoscore (IPS) for anti-PD1 and anti-CTLA4 therapies

  • Pathway enrichment: CD3D expression is associated with enrichment in critical immune pathways:

    • Antigen processing and presentation

    • T-cell receptor signaling

    • B-cell receptor signaling

    • Natural killer cell-mediated cytotoxicity

How should researchers address technical variability in Cd3d-focused experiments?

Managing technical variability is crucial for obtaining reproducible and reliable results in Cd3d research:

  • Protein quality control measures:

    • Implement batch testing for recombinant Cd3d preparations

    • Characterize each batch for purity, concentration, and activity

    • Develop standard functional assays with defined acceptance criteria

    • Monitor protein stability during storage with repeated testing

  • Experimental standardization:

    • Establish detailed standard operating procedures (SOPs)

    • Use consistent cell passage numbers in cell-based assays

    • Standardize stimulation conditions (concentration, timing, temperature)

    • Include internal controls in each experiment

  • Data normalization strategies:

    • Apply appropriate normalization methods for multiparametric data

    • Include technical and biological replicates

    • Use reference standards across experiments

    • Implement statistical approaches that account for batch effects

  • Validation across multiple systems:

    • Test findings in multiple cell lines or primary cell isolates

    • Confirm key results with complementary technical approaches

    • Validate in vivo findings across different mouse strains when possible

    • Cross-validate between recombinant protein studies and genetic models

What developments in single-cell analysis have advanced our understanding of Cd3d biology?

Recent advances in single-cell technologies have revolutionized our understanding of Cd3d biology by revealing previously unappreciated heterogeneity and dynamics:

  • Single-cell RNA sequencing applications:

    • Identification of distinct T-cell states based on Cd3d expression patterns

    • Discovery of Cd3d co-expression networks at single-cell resolution

    • Characterization of temporal dynamics during T-cell activation

    • Mapping of Cd3d expression across tissue-resident T-cell populations

  • Protein-level single-cell analysis:

    • Mass cytometry (CyTOF) for simultaneous detection of Cd3d and dozens of other proteins

    • Imaging mass cytometry for spatial context of Cd3d in tissue sections

    • Multiplex ion beam imaging for subcellular localization studies

  • Functional single-cell approaches:

    • Microfluidic systems for correlating Cd3d expression with cytokine production

    • Single-cell westerns for protein-level validation

    • Live-cell imaging combined with single-cell fate mapping

  • Computational integration:

    • Multi-modal data integration (transcriptomics, proteomics, metabolomics)

    • Trajectory analysis revealing Cd3d dynamics during T-cell differentiation

    • Machine learning approaches to predict functional states from Cd3d expression patterns

How do Cd3d knockout and CD3D humanized models complement each other in research?

Cd3d knockout and CD3D humanized models provide complementary insights that, when combined, offer a comprehensive understanding of CD3D biology:

  • Mechanistic insights:

    • Knockout models reveal the consequences of complete Cd3d absence

    • Humanized models demonstrate species-specific functions

    • Together they highlight both conserved and divergent aspects of CD3D biology

  • Therapeutic development pipeline:

    • Knockout models: Initial validation of CD3D as therapeutic target

    • Humanized models: Translation to human-specific therapeutics

    • Combined approach: Complete therapeutic development pathway

  • Developmental versus functional analysis:

    • Knockout models: Focus on developmental requirements

    • Humanized models: Emphasis on functional properties

    • Integrated view: Comprehensive picture of CD3D's role throughout T-cell lifespan

  • Experimental workflow integration:

Research QuestionKnockout Model ValueHumanized Model ValueCombined Benefit
Target validationEssential role identificationHuman-specific relevanceComplete therapeutic rationale
Antibody developmentNegative controlTesting platformFull antibody characterization
Signaling pathway analysisCore pathway identificationHuman-specific pathwaysTranslational pathway map
Safety assessmentIdentify critical functionsHuman-relevant toxicityComprehensive safety profile
  • Research applications:

    • Basic immunology: Knockout models provide foundational insights

    • Translational research: Humanized models bridge to clinical applications

    • Drug development: Both models necessary for complete therapeutic assessment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.