Recombinant Mouse T-lymphocyte activation antigen CD80 (Cd80)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms in Immune Regulation

CD80 interacts with CD28 and CTLA-4 receptors on T-cells, modulating immune responses through two distinct pathways:

  • Costimulation (via CD28): Enhances T-cell activation by amplifying TCR signaling, promoting NF-κB and MAPK pathways, and upregulating glucose metabolism via PI3K/Akt .

  • Inhibition (via CTLA-4): Suppresses T-cell activity to prevent autoimmunity, with 20–100× higher affinity for CTLA-4 than CD28 .

CD80 also regulates PD-L1/PD-1 interactions, limiting immune suppression in tumor microenvironments .

Cancer Immunotherapy

  • Soluble CD80-Fc Fusion Proteins: These constructs overcome PD-L1-mediated T-cell suppression by blocking PD-1 binding and costimulating CD28. In murine models, CD80-Fc outperformed anti-PD-1/PD-L1 antibodies in restoring T-cell activation .

  • Tumor Cell Transfection: Membrane-bound CD80 on tumor cells prevents PD-1-mediated apoptosis and enhances antitumor immunity .

Viral Immunology

  • Herpes Simplex Virus 1 (HSV-1): Viral expression of CD80 rescues latency and reactivation in LAT-null mutants, mimicking wild-type HSV-1 function. CD80 overexpression correlates with increased corneal scarring in C57BL/6 mice, highlighting its dual role in immune activation and pathology .

Autoimmune Disease Models

CD80 is a therapeutic target for autoimmune conditions due to its role in regulating B-cell/T-cell interactions in germinal centers, which are critical for humoral immunity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please specify your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. We recommend reaching out to your local distributors for the most up-to-date delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we suggest briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoted for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Cd80; B7; T-lymphocyte activation antigen CD80; Activation B7-1 antigen; CD antigen CD80
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
38-306
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNTLVLFGAGFGAVITVVVIVVIIKCFCKHRSCFRRNEASRETNNSLTFGPEEALAEQTVFL
Uniprot No.

Target Background

Function
CD80 plays a crucial role in T lymphocyte activation by providing a costimulatory signal. Binding of CD28 or CTLA-4 to CD80 triggers T-cell proliferation and cytokine production, essential for immune responses.
Gene References Into Functions
  1. CD80 plays a significant role in Th17 differentiation in Coxsackie virus B3-induced acute myocarditis. PMID: 29039143
  2. Research has identified an association between CD80 expression and bone mineral density, as well as the risk of osteoporosis. PMID: 28466138
  3. Studies have demonstrated that CD80 expressed by CD8(+) T cells contributes to PD-L1-induced apoptosis of activated CD8(+) T cells. PMID: 29181416
  4. TNFalpha is a key mediator of renal CD80 induction, leading to albuminuria. PMID: 27125280
  5. Findings do not support a role for B7-1 in podocyte biology. PMID: 27528551
  6. PD-L1 interacts with CD80 to regulate graft-versus-leukemia activity of donor CD8+ T cells. PMID: 28414296
  7. The PD-1 receptor plays a role in interacting with programmed cell death ligands and B7-1. PMID: 28270509
  8. Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD80. PMID: 24981893
  9. Genetic inactivation of B7.1/B7.2 exacerbates obesity-related liver steatosis and metabolic dysregulation, likely due to the absence of Tregs in these mice. This finding makes DKO mice a valuable model for studying NASH. PMID: 24845056
  10. Research indicates that B7H1/CD80 interaction enhances Tcon cell proliferation, IL-2 production, and PD-1 expression, ultimately leading to increased apoptosis. PMID: 25488990
  11. Silencing of CD40 and CD80 genes has synergistic effects in preventing allograft rejection, suggesting potential therapeutic applications in transplantation. PMID: 24886282
  12. Data highlight the crucial role of the adaptive immune system, particularly T cell CD80/86 costimulatory molecules, in regulating bone resorption and maintaining bone mass. PMID: 24807557
  13. CD80 and CD86 costimulatory molecules regulate OT-II CD4(+) T lymphocyte proliferation and cytokine response in cocultures with antigen-presenting cells derived from pregnant and pseudopregnant mice. PMID: 24771983
  14. The need for additional immune suppression in the intestine arises from commensal microbe-driven T-cell activation through ICOSL and OX40L in B7-deficient mice. PMID: 25002484
  15. Categorizing memory B cells based on CD80 and PD-L2 expression offers valuable insights into their function. PMID: 24880458
  16. B7.1 and B7.2 molecules exhibit equal capacity to mediate host resistance to Mycobacterium tuberculosis. PMID: 24099792
  17. Decitabine (DAC) induces CD80 expression in EL4 cells through demethylation of CpG dinucleotide sites in the CD80 gene promoter. PMID: 23671644
  18. CD80-Fc emerges as a promising therapeutic agent for overcoming PDL1-induced immune suppression and enhancing tumor-specific immunity. PMID: 23918985
  19. Activation of protective CD8 T cells requires positive B7-1/B7-2 costimulation, even when suppression by Tregs, particularly Treg-intrinsic CTLA-4, is bypassed. PMID: 23744647
  20. Macrophages from infected animals exhibit increased expression of PDL2 and CD80, influenced by the sex of the host. PMID: 23533995
  21. Isolated microglia display high surface expression of CD11c along with costimulatory molecules CD40, CD80, and CD86, essential for T-cell activation. PMID: 23439211
  22. Blockade of B7-1/B7-2 in NOD.AireGW/+ mice results in rapid, early-onset autoimmune peripheral neuropathy. PMID: 23487421
  23. While CD70 is necessary for dendritic cell-mediated delay of T cell tolerance induction, CD80 and CD86 are crucial for refunctionalizing tolerized T cells in prostate tumor tissue. PMID: 22798683
  24. Research has shown that iTregs can acquire CD80 and CD86 from mDCs, and the acquisition of CD86 may enhance their suppressive function. PMID: 22307040
  25. Mixed bone marrow chimeras demonstrated a B cell-intrinsic requirement for CD80 expression for normal T(FH) cell and PC development. PMID: 22450810
  26. Estrogen appears to down-regulate CD80 expression during B cell activation. Specifically, upon addition of 17beta-estradiol to cultured splenocytes, CD80 expression decreases while IgG production increases. PMID: 21726119
  27. B7-1 interactions with programmed death-1 ligand 1 (PD-L1) may play a critical role in regulating potentially pathogenic self-reactive effector T cells. PMID: 21697456
  28. B7-1 on stromal cells is a key molecule regulating IL-10 production by multifunctional Treg cells, HOZOT. PMID: 20628373
  29. Mice inoculated with H22 tumor cells expressing B7-1, B7-2, and 4-1BBL develop a robust cytotoxic T lymphocyte response and long-term immunity against wild-type tumor, suggesting a synergistic effect between the B7 and 4-1BBL costimulatory pathways. PMID: 20563597
  30. A novel immune regulation loop has been identified, involving T cell-derived interferon-gamma, B7H1 expression by antigen-presenting cells, and B7.1 expression by regulatory T (Treg) cells in an autoimmune-like graft-versus-host disease model. PMID: 21263067
  31. Maintenance of peripheral regulatory T-cell function crucially depends on the presence of classical dendritic cells expressing CD80/86. PMID: 21267999
  32. Inhibition of PU.1 expression by short interfering RNA in bone marrow-derived dendritic cells leads to a significant down-regulation of CD80 and CD86 expression. PMID: 21119111
  33. T cell-expressed CD80, compared to CD86, plays a significant role in limiting the expansion of effector CD8-positive cytotoxic T lymphocytes. PMID: 21115734
  34. Research highlights the requirement for B7-mediated signaling in regulating the CMV-specific CD4 T cell response and establishing host-virus equilibrium. PMID: 20980516
  35. In the absence of CD80/86, CD4 T cell priming remains intact, but secondary responses to intranasal administration of vaccinia virus are reduced. PMID: 21040905
  36. T-cell costimulation through B7 ligands CD80 and CD86 is essential for the development of experimental hypertension, suggesting that inhibiting this process could have therapeutic benefits in treating this disease. PMID: 21126972
  37. The interaction of CTLA4 and B7 inhibits Th17 differentiation in vitro and in vivo, suppressing Th17-mediated autoimmunity. Blocking the CTLA4-B7 interaction enhances Th17 cell differentiation in vitro and in vivo. PMID: 20601598
  38. These results demonstrate that signaling delivered by B7-1 and B7-2 plays a role in determining the outcome of group B streptococcal-induced arthritis, likely due to the differing local secretory pattern. PMID: 20114085
  39. Covalently linked dimers of B7-1 mediate strong and persistent early events in T cell-antigen presenting cell interaction and T cell activation. PMID: 20065109
  40. B7-1 and B7-2, but not PD-L1 and PD-L2, on IL-10-treated DC and DC-derived exosomes play a critical role in the immunosuppressive functions of both DC and exosomes. PMID: 19757438
  41. Direct signaling through B7-1 and B7-2 has been identified as a potent regulator of IgG secretion by previously activated B cells. PMID: 19933871
  42. Upregulation of CD80 and loss of constitutive CD86 expression on monocytes were associated with higher severity of illness and inflammation, confirming findings in a mouse model. PMID: 19672303
  43. CTLA-4 negatively affects the induction of T-cell immunity in vivo to B7-1+, but not B7-2+, murine myelogenous leukemia. B7-1 was important for the induction of CD8+ T-cell immunity in the absence of CTLA-4. PMID: 11877291
  44. Simultaneous expression of allogenic class II MHC and B7.1 (CD80) molecules in the A20 B-lymphoma cell line enhances tumor immunogenicity. PMID: 11911464
  45. B7-CTLA4 interaction promotes cognate destruction of tumor cells by cytotoxic T lymphocytes in vivo. B7-CD28 interaction enhances T-cell clonal expansion. PMID: 11929778
  46. CD80 plays a crucial role in mediating a down-regulatory effect on CD8+ CTL development, potentially through preferential binding to CTLA4. PMID: 11937530
  47. B7-1 is involved in deleting pathogenic autoreactive T cells in the thymus. PMID: 11956287
  48. There are distinct differences in the ability of LT and LT (E112K) to enhance B7-1 and B7-2 on APC, as well as a dependence upon these costimulatory molecules for their adjuvant properties. PMID: 12165495
  49. Findings indicate that B7-1a, an alternatively spliced form of B7-1, serves as a more effective costimulatory molecule than B7-1 or B7-2 in inducing and maintaining anti-tumor immune responses against a poorly immunogenic osteosarcoma cell line. PMID: 12174878
  50. Iron deficiency has differential effects on the expression of CD80 and CD86 co-stimulatory receptors in mitogen-treated and untreated murine spleen cells. PMID: 12210763

Show More

Hide All

Database Links
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on activated B-cells, gamma interferon stimulated monocytes and non-circulating B-cell malignancies.

Q&A

What is the molecular structure of mouse CD80 and how does it differ from human CD80?

Mouse CD80 is a ~60 kDa single-pass type I transmembrane glycoprotein that belongs to the immunoglobulin superfamily (IgSF). Its structure includes an extracellular region with an IgV-like domain followed by an IgC-like domain, a transmembrane region, and a cytoplasmic tail . Recombinant mouse CD80 protein typically encompasses amino acids 38-246, representing the functional extracellular domain . While human and mouse CD80 share significant structural homology, species-specific differences exist in amino acid sequence and glycosylation patterns that can affect binding affinities to their respective ligands, which should be considered when designing cross-species experiments.

What are the primary cellular expression patterns of CD80 in the mouse immune system?

CD80 is variably expressed on multiple immune cell types in mice, primarily on activated B cells, activated CD4+ and CD8+ T cells, macrophages, and dendritic cells . Expression is typically low or absent on resting cells and is upregulated following activation. When designing experiments, researchers should account for this differential expression pattern by either using appropriate stimulation protocols to induce CD80 expression or selecting specific timepoints post-activation for analysis. Flow cytometry with appropriate controls is the recommended method for quantifying CD80 expression across different immune cell populations.

What signaling pathways are activated by CD80 engagement with its receptors?

CD80 engagement with CD28 on T cells activates several key signaling pathways. This interaction triggers the PI3K/Akt signaling pathway, which stimulates glucose metabolism and ATP synthesis in T cells . Additionally, CD80-CD28 binding activates NF-kappa-B and MAPK pathways, leading to cytokine production . These pathways collectively enhance T cell activation, proliferation, and survival. In contrast, CD80 binding to CTLA-4 (CD152) generates inhibitory signals for T cell responses, demonstrating the dual regulatory role of CD80 . Experimental designs investigating CD80 function should consider both stimulatory and inhibitory outcomes depending on the receptor context.

How should recombinant mouse CD80 be reconstituted and stored to maintain optimal activity?

Recombinant mouse CD80 protein should be reconstituted in sterile, buffer-appropriate conditions according to the manufacturer's specifications. Typically, lyophilized protein should be reconstituted in sterile water or phosphate-buffered saline (PBS) to a concentration of 0.1-1.0 mg/mL. For long-term storage, aliquot the reconstituted protein to avoid repeated freeze-thaw cycles and store at -80°C. Working aliquots can be stored at 4°C for up to one week. Prior to experimental use, centrifuge the protein solution briefly to remove any precipitates. Protein activity should be verified periodically using functional assays such as T cell stimulation or binding assays to ensure the protein maintains its biological activity.

What experimental approaches can effectively measure CD80-CD28 interactions in vitro?

Several methodological approaches can be employed to assess CD80-CD28 interactions:

  • Co-immunoprecipitation: Using anti-CD80 or anti-CD28 antibodies to pull down protein complexes, followed by Western blot analysis.

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics and affinity between recombinant CD80 and CD28 proteins.

  • ELISA-based binding assays: Using immobilized CD80 or CD28 to detect interaction with the corresponding partner.

  • Functional T cell assays: Measuring T cell proliferation, cytokine production, or activation markers after stimulation with anti-CD3 antibodies in the presence or absence of recombinant CD80.

  • Flow cytometry-based binding assays: Using fluorescently labeled CD80 to detect binding to CD28-expressing cells.

When conducting these experiments, appropriate controls should include blocking antibodies against CD80 or CD28, isotype controls, and comparison with known CD80 ligands.

How can researchers effectively validate the functionality of recombinant mouse CD80 protein?

Validating recombinant mouse CD80 functionality requires multiple approaches:

Validation MethodProcedureExpected OutcomeControl
SDS-PAGERun protein on gel under reducing conditionsSingle band at ~60 kDaMolecular weight markers
Western BlotProbe with anti-CD80 antibodySpecific band at expected MWSecondary antibody only control
T Cell ProliferationCo-stimulate T cells with anti-CD3 + CD80Enhanced proliferation compared to anti-CD3 aloneAnti-CD28 blocking antibody
Binding AssayIncubate with CD28+ cellsBinding detected by flow cytometryCTLA-4-Ig to block binding
Cytokine InductionMeasure IL-2 production after T cell stimulationIncreased IL-2 with CD80 co-stimulationIsotype control protein

How does CD80 acquisition by T cells impact experimental interpretation and what methodologies can distinguish acquired versus endogenously expressed CD80?

CD80 acquisition by T cells represents a critical consideration in experimental design and data interpretation. Research has demonstrated that CD4+ T cells can acquire CD80 from antigen-presenting cells (APCs) at early stages of activation (24 hours), which is not due to endogenous upregulation but rather intercellular transfer . This phenomenon has significant implications for interpreting CD80 positivity on T cells in experimental settings.

To distinguish between acquired and endogenously expressed CD80:

  • Cycloheximide treatment: Treating T cells with protein synthesis inhibitors like cycloheximide before co-culture with APCs can confirm CD80 acquisition rather than de novo synthesis .

  • mRNA analysis: RT-PCR for CD80 mRNA in T cells showing CD80 protein expression can determine whether the protein is endogenously produced .

  • Time-course experiments: CD80 acquisition occurs rapidly (within 24 hours) while endogenous expression typically requires longer activation periods.

  • Fluorescent labeling: Pre-labeling APC-expressed CD80 with fluorescent tags can track transfer to T cells.

Importantly, T cells that acquire CD80 from APCs can themselves stimulate other T cells, potentially amplifying immune responses in experimental systems . This mechanism should be considered when interpreting T cell activation data in co-culture systems.

What role does CD80 play in multiple sclerosis models, and how should experiments be designed to investigate this connection?

Research indicates important connections between CD80 expression and multiple sclerosis (MS) pathophysiology. Studies have shown reduced CD80 expression in Epstein-Barr virus (EBV)-infected B cells (LCLs) from MS patients compared to healthy donors, with this reduction being more pronounced in females . The relationship between CD40 and CD80 expression appears particularly relevant, as there is interdependence between CD40 and CD80 protein levels in MS-derived LCLs but not in healthy donor cells .

When designing experiments to investigate CD80's role in MS models:

  • Sex-stratified analysis: Given the more pronounced CD80 expression differences in females with MS, experiments should be stratified by sex .

  • EBV variant consideration: The type of EBV used in experimental systems affects CD80 expression, with endogenous EBV variants showing different effects than laboratory strains like B95.8 .

  • Genetic background assessment: Host genetic variants may interact with CD80 expression patterns, necessitating genotyping for MS-associated SNPs in experimental subjects .

  • Combined CD40/CD80 analysis: The interdependence between CD40 and CD80 suggests both should be analyzed simultaneously in MS research contexts .

  • Flow cytometry protocols: For accurate quantification of CD80 expression differences, standardized flow cytometry protocols with appropriate isotype controls and consistent gating strategies are essential.

How can researchers implement experimental controls to distinguish between the stimulatory and inhibitory functions of CD80 in T cell activation studies?

CD80 exhibits dual functionality through its interactions with both CD28 (stimulatory) and CTLA-4 (inhibitory) on T cells . Designing experiments that can distinguish between these opposing functions requires careful control implementation:

  • Receptor-blocking experiments: Utilize specific blocking antibodies or fusion proteins (soluble CTLA-4, CD28, and CD80) to selectively prevent interaction with either CD28 or CTLA-4 .

  • Temporal analysis: Since CD28 is constitutively expressed while CTLA-4 is upregulated after activation, time-course experiments can help distinguish early (predominantly CD28-mediated) versus late (mixed CD28/CTLA-4-mediated) effects.

  • Genetic approaches: Use CD28-knockout or CTLA-4-knockout T cells to isolate effects mediated by each receptor.

  • Dose-response relationships: CD80 typically binds CTLA-4 with higher affinity than CD28, so titrating CD80 concentrations can help differentiate between predominantly stimulatory (lower concentrations) versus inhibitory (higher concentrations) effects.

  • Functional readouts: Include multiple readouts that differentially reflect stimulatory versus inhibitory signaling, such as proliferation, IL-2 production (stimulatory), and markers of T cell exhaustion (inhibitory).

What are the critical quality control parameters for recombinant mouse CD80 protein used in experimental systems?

When using recombinant mouse CD80 protein in research, several quality control parameters should be routinely assessed:

  • Purity assessment: Recombinant mouse CD80 should demonstrate ≥90% purity by SDS-PAGE analysis . Contaminants can affect experimental outcomes, particularly in sensitive assays like T cell activation studies.

  • Endotoxin testing: Endotoxin levels should be <0.1 EU/μg protein, as endotoxin contamination can independently activate immune cells and confound results.

  • Protein conformation: CD80's functional activity depends on proper protein folding; techniques like circular dichroism spectroscopy can verify secondary structure integrity.

  • Glycosylation analysis: As a glycoprotein, CD80's functionality may be affected by glycosylation patterns, which can vary between expression systems. Expression in mammalian systems like HEK293 cells provides more physiologically relevant glycosylation .

  • Functional validation: Biological activity should be confirmed using binding assays with recombinant CD28 and CTLA-4, as well as T cell co-stimulation assays measuring proliferation or cytokine production.

  • Batch consistency: Experimental consistency requires using the same protein batch throughout a study or validating batch-to-batch equivalency through standardized functional assays.

How can researchers optimize flow cytometry protocols for accurate detection and quantification of CD80 in different mouse immune cell populations?

Flow cytometry optimization for CD80 detection requires addressing several technical considerations:

  • Antibody selection: Choose anti-CD80 antibody clones with validated specificity for mouse CD80. The 2D10.4 clone has been well-characterized for specificity .

  • Fluorochrome pairing: Select fluorochromes based on instrument configuration and other markers in the panel. PE-conjugated anti-CD80 antibodies offer good sensitivity for detecting varying CD80 expression levels .

  • Titration curves: Perform antibody titration to determine optimal concentration that maximizes signal-to-noise ratio.

  • Blocking strategy: Include Fc receptor blocking to prevent non-specific binding, particularly important when analyzing macrophages and dendritic cells.

  • Controls implementation:

    • Isotype controls at the same concentration as the test antibody

    • Fluorescence-minus-one (FMO) controls for accurate gating

    • Positive controls (LPS-stimulated B cells) and negative controls (resting T cells)

  • Viability discrimination: Include viability dyes to exclude dead cells, which can bind antibodies non-specifically.

  • Standardization: Use calibration beads to standardize fluorescence intensity across experiments and instruments.

  • Sample processing considerations: Minimize time between sample collection and staining, and maintain consistent processing protocols to reduce variability in CD80 detection.

What strategies can address common challenges in studying CD80 acquisition by T cells from antigen-presenting cells?

Investigating CD80 acquisition by T cells presents several methodological challenges that can be addressed through the following strategies:

  • Distinguishing acquisition from upregulation:

    • Use RNA analysis (RT-PCR) to confirm absence of CD80 mRNA in T cells that display CD80 protein

    • Employ protein synthesis inhibitors like cycloheximide during co-culture experiments

    • Design time-course experiments capturing very early timepoints (CD80 acquisition occurs within 24 hours)

  • Quantifying acquisition efficiency:

    • Standardize APC:T cell ratios in co-culture experiments

    • Utilize FACS-sorted populations to ensure cell purity

    • Implement cell tracking dyes to distinguish populations during analysis

  • Visualizing the acquisition process:

    • Use confocal microscopy with fluorescently labeled CD80 to directly observe transfer

    • Implement live-cell imaging to capture the dynamics of acquisition

  • Controlling for confounding factors:

    • Include transwell experiments to confirm cell-cell contact requirement

    • Use blocking antibodies (anti-CD28, anti-CD80) to assess receptor dependency

    • Compare results across different types of APCs with varying CD80 expression levels

  • Functional verification:

    • Test whether T cells that have acquired CD80 can stimulate other T cells

    • Measure functional outcomes like cytokine production or proliferation

By implementing these methodological approaches, researchers can more accurately characterize the biological significance of CD80 acquisition by T cells and its potential immunoregulatory implications.

What are emerging methodologies for studying CD80's role in T cell-mediated immune responses?

Recent technological advances offer new opportunities for investigating CD80 biology:

  • Single-cell RNA sequencing: Enables correlation of CD80 expression with comprehensive transcriptional profiles at individual cell resolution, revealing heterogeneity in CD80-expressing populations.

  • CRISPR-Cas9 genetic modifications: Allows precise editing of CD80 gene or its regulatory elements to study structure-function relationships and expression control mechanisms.

  • Sophisticated imaging techniques: Super-resolution microscopy and intravital imaging provide insights into CD80 clustering, interaction dynamics, and in vivo behavior during immune responses.

  • Biosensors and reporter systems: Development of CD80-interaction biosensors can enable real-time monitoring of CD80-CD28/CTLA-4 binding events in living cells.

  • Organoid and 3D culture systems: These more physiologically relevant models can better recapitulate CD80's role in tissue-specific immune environments compared to traditional 2D cultures.

These methodologies will help address fundamental questions about spatiotemporal dynamics of CD80 expression and its functional consequences in complex immune responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.