Recombinant Mouse T-lymphocyte activation antigen CD86 (Cd86)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Classification

CD86, also known by several synonyms including B7-2, B70, and Ly-58, is a type I transmembrane glycoprotein and member of the immunoglobulin superfamily of cell surface receptors . This protein is encoded by the Cd86 gene in the mouse genome and functions as a critical receptor in immune activation pathways . The protein has been thoroughly characterized and is registered under multiple database identifiers, including UniProt ID P42082 and PRO ID PR:P42082, facilitating cross-reference across scientific databases . As a member of the B7 family of costimulatory molecules, CD86 shares structural and functional similarities with CD80 (B7-1), though with distinct expression patterns and functional properties.

Immunological Functions

CD86 serves as a receptor involved in the costimulatory signaling essential for T-lymphocyte proliferation and interleukin-2 production, primarily through its interactions with CD28 or CTLA-4 . This protein plays a critical role in the early events of T-cell activation and costimulation of naive T-cells, particularly in determining between immunity and anergy—a decision made by T-cells within 24 hours after activation . The interaction between CD86 on antigen-presenting cells and CD28 on T cells results in enhanced T-cell activation, proliferation, and cytokine production .

Beyond T-cell regulation, CD86 is also involved in B-cell function regulation and plays a role in controlling IgG(1) production levels . Additionally, the protein participates in immunoglobulin class-switching and activates NK cell-mediated cytotoxicity . These diverse functions position CD86 as a central regulator in both adaptive and innate immune responses.

Signaling Mechanisms

The signaling mechanisms of CD86 involve several molecular pathways that collectively regulate immune activation. Upon CD40 engagement, CD86 activates the NF-kappa-B signaling pathway through phospholipase C and protein kinase C activation . This signaling cascade results in the production of inflammatory cytokines and the modulation of immune cell behavior.

The costimulatory signals provided by CD86 complement the primary signals delivered through T-cell receptor engagement with peptide-MHC complexes. While CD86 typically provides activating signals through CD28, it can also bind to CTLA-4 to deliver inhibitory signals to T cells, demonstrating its dual role in immune regulation . This balance between activating and inhibitory functions helps maintain immune homeostasis and prevents excessive inflammatory responses.

Cellular Distribution

CD86 exhibits a specific pattern of expression across immune cell populations. The protein is expressed at high levels on resting peripheral monocytes and dendritic cells, indicating its constitutive role in these antigen-presenting cells . In contrast, resting B and T lymphocytes express CD86 at very low density levels . This differential expression pattern positions CD86 as a key regulator of immune responses initiated by professional antigen-presenting cells.

Research has demonstrated that CD86 is expressed earlier in the immune response compared to the related molecule CD80 . This temporal difference in expression suggests distinct roles for these two costimulatory molecules during the evolution of an immune response, with CD86 potentially being more important in the initiation phase while CD80 may play a more significant role in sustaining the response.

Regulation of Expression

The expression of CD86 is dynamically regulated during immune responses. Upon activation, CD86 expression is rapidly upregulated on various immune cell types . This upregulation facilitates enhanced costimulatory capacity and promotes T-cell activation. The regulation of CD86 expression involves complex transcriptional and post-transcriptional mechanisms that respond to inflammatory stimuli and immune activation signals.

Interestingly, research has shown differential regulation of CD80 and CD86 expression in sepsis models, suggesting divergent roles for these receptors in inflammatory conditions . In human studies, upregulation of CD80 and loss of constitutive CD86 expression on monocytes was associated with higher severity of illness and inflammation, confirming the findings in mouse models . This differential regulation may provide opportunities for targeted therapeutic interventions in inflammatory diseases.

CD86 in Sepsis Models

Studies using cecal ligation and puncture (CLP) models have provided valuable insights into the role of CD86 in sepsis. Mice deficient in both CD80 and CD86 (CD80/86−/−) display reduced mortality and inflammatory cytokine production after CLP, indicating the importance of these costimulatory molecules in regulating inflammation during sepsis .

The innate immune response during the early stages of sepsis is significantly influenced by costimulatory molecules like CD86. These molecules can regulate inflammation through macrophage/neutrophil contact, highlighting their role beyond adaptive immunity . The involvement of CD86 in the innate immune response to sepsis represents an important area of ongoing research with potential therapeutic implications.

Differential Roles of CD80 and CD86

One of the most striking findings in recent research is the differential role of CD80 and CD86 in regulating inflammation during sepsis. CD80−/− mice demonstrated improved survival after CLP compared to both wild-type and CD86−/− mice . This survival advantage was associated with preferential attenuation of inflammatory cytokine production, specifically IL-6 and IL-1β, in CD80−/− mice .

The differential effects of CD80 and CD86 deficiency on cytokine production and survival outcomes are summarized in the following table:

These findings were further confirmed through pharmacological interventions, as anti-CD80 monoclonal antibody treatment rescued mice when administered either before or after CLP . The mechanism behind this differential regulation appears to involve the selective disassociation of IRAK-M, a negative regulator of NF-κB signaling, from CD80 during macrophage activation with neutrophil lipid rafts . This molecular mechanism provides a potential explanation for the preferential regulation of cytokine production by CD80 compared to CD86.

Expression Systems and Production

Recombinant mouse CD86 can be successfully produced using insect cell expression systems. The sf Insect Cell system has been employed to generate high-quality recombinant CD86 protein with appropriate post-translational modifications . The recombinant protein is typically produced as a fusion protein with an Fc tag, which facilitates purification and detection in various applications .

Production of recombinant CD86 typically involves the following steps:

  1. Expression of the protein in sf Insect Cells

  2. Purification using affinity chromatography

  3. Quality control through SDS-PAGE and silver staining

  4. Endotoxin testing using the LAL method

  5. Sterile filtration (0.2 μm) and lyophilization

The resulting recombinant protein demonstrates >95% purity by SDS-PAGE and contains less than 0.1 EU/μg of endotoxin, ensuring its suitability for various research applications .

Biological Activity and Functional Assays

The biological activity of recombinant mouse CD86 can be determined through functional assays that measure its ability to induce IL-2 secretion by human acute leukemia T cells in the presence of PHA (phytohemagglutinin) . This assay provides a quantitative measure of the protein's functional integrity and potency. The expected ED₅₀ value for recombinant mouse CD86 in this assay ranges from 0.05 to 0.15 μg/ml, indicating high biological activity .

Research Applications

Recombinant mouse CD86 finds application in various research areas, particularly in studies investigating T-cell activation, immune regulation, and inflammatory processes. Common applications include:

  1. ELISA-based assays for detecting CD86-binding partners

  2. Functional studies of T-cell activation and costimulation

  3. Investigation of immunomodulatory pathways

  4. Development of therapeutic strategies targeting CD86-mediated pathways

  5. Structure-function studies of costimulatory molecules

The availability of high-quality recombinant CD86 has facilitated significant advances in our understanding of costimulatory pathways and their role in health and disease.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cd86; T-lymphocyte activation antigen CD86; Activation B7-2 antigen; Early T-cell costimulatory molecule 1; ETC-1; CD antigen CD86
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-309
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE
Uniprot No.

Target Background

Function
CD86, also known as B7-2, is a receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production. It achieves this by binding to CD28 or CTLA-4. CD86 plays a crucial role in the early stages of T-cell activation and costimulation of naive T-cells, influencing the decision between immunity and anergy within 24 hours of activation. It is also involved in regulating B cell function, particularly in modulating the levels of IgG(1) produced. Upon CD40 engagement, CD86 activates the NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation.
Gene References Into Functions
  1. Our research highlights the role of B7-2 as an essential receptor for superantigens. B7-2 homodimer interface mimotopes effectively prevent superantigen lethality by inhibiting the interaction between the superantigen and the host costimulatory receptor. PMID: 27708164
  2. Findings suggest that the TLR2-p38-CD86 signaling pathway is critical in burn injury-associated inflammation. PMID: 28460187
  3. CD86 collaborates with CD40 in the primary germinal center generation of distinct antigen-presenting cells. PMID: 28768709
  4. B7.2 expressed on skin CD8(+) T cells supports the survival of Tregs, likely through interaction with its receptor CTLA-4, which is highly expressed on skin Tregs. PMID: 27183612
  5. Low CD86 expression is associated with B16 melanoma. PMID: 26485753
  6. Local administration of CD86 siRNA during the effector phase ameliorates asthma phenotypes. PMID: 25344652
  7. Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD86. PMID: 24981893
  8. This study unveils a novel function of CTLA4Ig in tumor immunity and suggests that CD86 on NK cells acts as an activating receptor, playing a crucial role in the CTLA4Ig-mediated anti-tumor response. PMID: 24349559
  9. CD4(+) NKG2D(+) T cells induce NKG2D down-regulation in natural killer cells in CD86-RAE-1epsilon transgenic mice. PMID: 24708417
  10. CD86 expression significantly impacts the magnitude of CD4 T cell responses both in vitro and in vivo. These findings highlight CD86 upregulation as an additional mechanism by which IL-21 exerts immunomodulatory effects. PMID: 24470500
  11. The presented data demonstrate that the recruitment and expression of MHC-II, CD80, CD86, PDL1, and PD-L2 in peritoneal cavity macrophages during early T. crassiceps infection is linked to the host's sex. PMID: 23533995
  12. Combinatorial signaling through TLR-2 and CD86 enhances B-cell receptor-free activation and differentiation of resting B cells. PMID: 23365665
  13. Phb1/2 and the CD86 cytoplasmic domain collaborate to mediate CD86 signaling in a B cell through differential phosphorylation of distal signaling intermediates, leading to increased IgG1 production. PMID: 23241883
  14. In response to Pseudomonas infection, mobilized neutrophils upregulate and provide B7 trans-costimulatory signals to T cells, preventing established lung allograft tolerance. PMID: 23018463
  15. Data indicate that most toll-like receptor (TLR) ligands induce comparable upregulation of co-stimulatory molecules CD40, CD86, and B7H1 on young and aged conventional dendritic cells (cDC). PMID: 22231652
  16. Interaction between CD28 and B7 molecules is essential for regulating splenic and bone marrow plasma cells. PMID: 22908331
  17. B7 and CD28 interactions promote the proliferation and survival of murine gammadelta T cells following Plasmodium infection. PMID: 22732586
  18. Yeast-derived beta-glucan exhibits no cytotoxic effects towards B-lymphoma cells, but its ability to upregulate CD86 suggests maturation of these cells via dectin-1 by the carbohydrate. PMID: 22199280
  19. Ubiquitin-mediated regulation of CD86 protein expression by the ubiquitin ligase membrane-associated RING-CH-1 (MARCH1). PMID: 21896490
  20. Parasite-induced B7-2 expression depends on Jun N-terminal protein kinase (JNK) but not on extracellular signal-regulated kinase or p38 signaling; its expression on human peripheral blood monocytes is also dependent on JNK signaling. PMID: 21911468
  21. These studies suggest that ubiquitination serves as a crucial mechanism by which dendritic cells control CD86 expression. PMID: 21849678
  22. T-cell costimulation via B7 ligands (CD80 and CD86) is essential for the development of experimental hypertension; inhibiting this process could offer therapeutic benefits in treating this disease. PMID: 21126972
  23. CD86 is critical for naive CD4+ T cell activation in vivo and differentiation into either a Th1 or Th2 phenotype. PMID: 11937530
  24. B7-2 plays a significant role in deleting pathogenic autoreactive T cells in the thymus. PMID: 11956287
  25. B cell-associated B7-2 expression is regulated by stimulation of the B cell receptor and/or the beta 2-adrenergic receptor in vivo and in vitro. PMID: 12055247
  26. Activation-induced up-regulation of B7-2 on antigen-presenting cells leads to increased CD28 signaling and a commitment to cross-priming of CD4-dependent cytotoxic T lymphocytes. PMID: 12370335
  27. CD86 plays a role in enhancing cell-cycle progression and survival of CD4(+) T lymphocytes after activation. PMID: 12429713
  28. Investigation of the fate of LACK-specific CD4+ T cells in Leishmania-infected BALB/c mice treated with or without anti-CD86 mAb. PMID: 12516542
  29. While CD86 plays a crucial role in T-dependent IgG and IgE responses of B cells to in vivo antigenic challenge, direct CD86 signaling of a B cell is not essential for its efficient activation. PMID: 12517941
  30. Stimulation by CD86, either alone or in conjunction with beta 2-AR on a CD40ligand/IL-4 activated B cell, increases both the level and rate of mature IgG1 transcription without affecting transcript stability or class switching to IgG1. PMID: 12734361
  31. B7-2 and B7-1 have overlapping functions in the endogenous superantigen-mediated deletion of TCR V beta 11- or V beta 12-bearing thymocytes. PMID: 12759417
  32. B7-2 overexpression on transgenic donor T cells mediates reduced alloresponsiveness and mortality in graft-vs-host disease compared with wild-type T cells. PMID: 14688306
  33. Stimulation of matured bone marrow dendritic cells with anti-CD80 monoclonal antibody upregulates CD86 levels on the cell surface. Coculture of these cells with naive, allogeneic T cells downregulates Th1 responses and upregulates suppressor responses. PMID: 14966193
  34. T cells activated in the presence of parenchymal cells from the eye express B7-2 in a manner that enables them to suppress bystander T cells. Therefore, B7-2 expression on T cells contributes to their eventual ability to function as regulators in vitro. PMID: 15034031
  35. Increased surface expression on Mycobacterium tuberculosis secretory antigen (MTSA)-activated dendritic cells after stimulation with M. tuberculosis cell extract downregulates the Th1 cells response to Mycobacterial antigens. PMID: 15116295
  36. B7-2 plays a critical role in priming pancreatic islet-reactive CD4 T cells: B7-2 deficiency results in a significant reduction in the generation of spontaneously activated CD4 T cells and islet-specific CD4 T cell expansion. PMID: 15356107
  37. Increased B7-2 expression on islet-infiltrated nonobese diabetic (NOD) mouse B cells is associated with enhanced T cell costimulation and the development of inflammatory insulitis in NOD mice. PMID: 15634886
  38. CD86 plays a vital role in the induction of anterior chamber-associated immune deviation. PMID: 15778288
  39. CD86 cannot be expressed on keratinocyte stem cells. PMID: 15808622
  40. Upregulated in SV5 infection of dendritic cells in both BALB/c and C57BL/6 mice strains. PMID: 15919909
  41. Tolerance might be induced by B7-driven negative regulatory signaling, but its maintenance relies on a lack of signal 2 (B7.2), as B7 expression is eventually lost in vivo. PMID: 16002674
  42. CD86 is protective in glomerulonephritis by enhancing Th2 and attenuating Th1 responses. PMID: 16014035
  43. CD86 is not required for oral tolerization. PMID: 16439314
  44. CD86 induces a previously unknown signal transduction pathway that regulates the level of B cell gene expression and activity proximal to NF-kappa B activation. PMID: 16709832
  45. B7-1 and B7-2 contribute differently to the development of T cell-mediated experimental allergic conjunctivitis during the induction and effector phases. PMID: 17109973
  46. Data suggest that anti-B7-2 monoclonal antibody B7 molecules can trigger innate-effector responses in macrophages by activating NF-kappaB, and are not only essential for inducing adaptive immune responses but also play roles in innate immunity. PMID: 17314080
  47. B7-2 promotes the generation of a mature antigen-presenting cell (APC) repertoire and enhances APC function and survival. PMID: 17475851
  48. Either CD80- or CD86-costimulation is indispensable for the induction of oral sensitization and IgE-mediated hypersensitivity to peanut, with CD86 being the most important ligand in inducing peanut extract-specific IgE responses. PMID: 17513738
  49. CD86 plays a key role in regulating the level of B-cell IgG1 produced in vitro and in vivo. PMID: 17641017
  50. While CD86 does not initially stimulate a response as strongly as CD80, it exhibits greater sustained activity, even in the absence of continued costimulation. PMID: 17947667

Show More

Hide All

Database Links

KEGG: mmu:12524

STRING: 10090.ENSMUSP00000087047

UniGene: Mm.1452

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on activated B-cells.

Q&A

What is mouse CD86 and what are its fundamental molecular characteristics?

Mouse CD86 (also known as B7-2, B70, Ly-58, CD-86) is an 80kD Ig superfamily member that functions as a type I transmembrane glycoprotein. It is involved in immunoglobulin class-switching and activation of NK cell-mediated cytotoxicity . The protein contains an extracellular domain, a transmembrane region, and a cytoplasmic tail. Although the predicted molecular weight of recombinant mouse B7-2 is 51.8 kDa, the actual observed molecular weight on SDS-PAGE is typically 60-65 kDa due to post-translational modifications . These modifications, particularly glycosylation, are essential for the protein's proper folding and biological function.

How does CD86 expression differ across immune cell types?

CD86 is expressed at high levels on resting peripheral monocytes and dendritic cells, while maintaining very low density on resting B and T lymphocytes . This differential expression pattern is physiologically significant because CD86 expression is rapidly upregulated by B cell-specific stimuli, with peak expression occurring between 18 to 42 hours after stimulation . Importantly, CD86 is expressed earlier in the immune response than its related molecule CD80 . This temporal expression pattern suggests CD86 plays a particularly crucial role in the initial phases of immune response activation, serving as the major CD28 ligand expressed early in the immune response sequence .

What signaling pathways does CD86 engage to mediate its biological effects?

CD86 serves as a receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production through binding to CD28 or CTLA-4 . Upon CD40 engagement, CD86 activates the NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation . This activation cascade is critical for subsequent immune cell functions. CD86, along with CD80, provides the essential "second signal" for T cell activation, complementing the first signal delivered through the T cell receptor (TCR). The ligation of CD28 on T cells with CD80 and CD86 on antigen-presenting cells (APCs) co-stimulates T cells, resulting in enhanced cell activation, proliferation, and cytokine production .

What are optimal expression systems for producing recombinant mouse CD86?

Recombinant mouse CD86 can be effectively produced using several expression systems, each with distinct advantages. The search results indicate successful production in both sf insect cells and HEK 293 cells . The choice of expression system depends on experimental requirements:

Expression SystemAdvantagesTypical Applications
sf Insect CellsHigher yield, potential for proper foldingFunctional assays, structural studies
HEK 293Mammalian glycosylation patterns, higher authenticitySensitive immunological studies, in vivo applications

For producing biologically active recombinant mouse CD86, the expression construct should include amino acids 24-245 (the extracellular domain) for fragment proteins or can be produced as Fc fusion proteins for enhanced stability and detection . Purification typically achieves >95% purity as determined by SDS-PAGE and silver staining, with endotoxin levels maintained below 0.1 EU/μg to prevent interference in immunological assays .

How can researchers validate the biological activity of recombinant CD86?

The biological activity of recombinant mouse CD86 can be determined through its ability to induce IL-2 secretion by human acute leukemia T cells. The expected ED₅₀ typically ranges from 0.05-0.15 μg/ml in the presence of phytohemagglutinin (PHA) . This functional assay directly measures the protein's ability to provide costimulatory signals.

Additional validation methods include:

  • Binding assays to verify interaction with CD28 and CTLA-4 receptors

  • T cell proliferation assays measuring co-stimulatory function

  • Flow cytometry to confirm proper folding through antibody recognition

  • Western blotting to verify molecular weight (noting that the observed weight of 60-65 kDa typically differs from the predicted weight of 51.8 kDa due to glycosylation)

What are critical considerations when designing experiments with recombinant CD86?

When designing experiments using recombinant mouse CD86, researchers should consider several factors that may influence experimental outcomes:

  • Target cell populations: CD86 has distinct effects on resting versus activated T cells. CD86 can be substantially inferior in costimulating alloresponses by separated memory T cells compared to naive cells, and some research indicates it may be completely incompetent in costimulating certain human T cell clones .

  • Expression context: CD80/CD86 double transfectants have been shown to stimulate lower responses by T cell clones than cells expressing CD80 alone, suggesting potential inhibitory effects of CD86 in certain contexts .

  • CTLA-4 interactions: CD86 can bind to CTLA-4 to deliver an inhibitory signal to T cells . Experiments should account for this dual functionality by potentially including anti-CTLA-4 Fab to fully restore proliferative responses in some experimental systems .

  • Formulation considerations: Recombinant proteins are typically provided in lyophilized form and require appropriate reconstitution before use. Proper storage and handling are essential to maintain biological activity .

How does CD86 interact with the broader immune checkpoint network?

CD86 functions within a complex network of immune checkpoint molecules. Gene expression correlation analyses reveal significant relationships between CD86 and several key immune regulatory molecules:

  • CD86 and CTLA4 show a strong positive correlation (P < .001, r = 0.77) , suggesting coordinated regulation.

  • CD86 has a negative correlation with CD8 (P < .001, r = ‒0.53) , indicating potential opposing regulation.

  • CD8 positively correlates with CTLA4 (P < .001, r = 0.56), CD103 (P < .001, r = 0.67), and PD-L1 (P < .001, r = 0.74) .

These correlation patterns differ between complete response and incomplete response groups in clinical settings. In complete response groups, CD86, CD80, and CD103 show strong correlations, with a negative correlation between CD86 and CD80 (P = .019, r = ‒0.94) and a positive correlation between CD80 and CD103 (P = .034, r = 0.91) . Notably, CD86 does not correlate with CTLA4 in complete response patients, contrasting with the strong positive correlation (P < .001, r = 0.83) seen in non-responders .

What role does CD86 play in tumor microenvironments?

CD86 appears to participate significantly in immune invasion in Acute Myeloid Leukemia (AML) and is an important player in the tumor microenvironment . Analysis of CD86 expression in AML samples reveals:

  • Differential expression of chemokines, immunostimulators, MHC proteins, and immune receptors between high vs. low CD86 expression groups .

  • Altered immune cell infiltration patterns correlated with CD86 expression levels, as determined by multiple analytical tools (CIBERSORT, MCPcounter, TIMER, Quantiseq, and Xcell) .

  • Correlations between CD86 expression and common immune checkpoint blockers (ICBs) .

The ESTIMATE algorithm identified 308 up-regulated genes and 16 down-regulated genes associated with CD86 expression levels in AML, highlighting its broad influence on the tumor immune landscape . Understanding CD86's role in the tumor microenvironment provides insights for immunotherapy approaches targeting this pathway.

How can low CD86 expression serve as a predictive biomarker in research models?

Low CD86 expression has emerged as a potential predictive biomarker for clinical response in certain therapeutic contexts . Research indicates that patients with cervical cells showing low CD86 expression exhibit different therapeutic response patterns compared to those with high CD86 expression. This differential response is associated with distinct molecular signatures:

These findings suggest CD86 expression levels could serve as a stratification marker in experimental models and potentially guide personalized therapeutic approaches in clinical settings.

How can researchers reconcile contradictory results in CD86 functional studies?

Contradictory outcomes in CD86 research may reflect differences in experimental systems and readouts. The literature acknowledges that "conflicting results and contradictory outcomes may reflect the different model systems and readouts used" . To address this challenge, researchers should consider:

  • Cell type specificity: CD86 has distinct effects on naive versus memory T cells, and these differences must be accounted for when comparing studies .

  • Experimental context: The presence of other costimulatory molecules, particularly CD80, can significantly alter CD86 functionality. CD80/CD86 double transfectants have been shown to stimulate lower responses than cells expressing CD80 alone in some contexts .

  • Inhibitory pathway involvement: Evidence indicates that "CD86 was actively inhibitory rather than merely neutral," as demonstrated by increased responses to CD80/CD86 double-expressing APCs when anti-CD86 antibody was added .

  • CTLA-4 interactions: Addition of anti-CTLA-4 Fab to cultures of HLA-DR1 transfectants co-expressing CD86 can fully restore proliferative responses, indicating that "CTLA-4 ligation may dominate the outcome of CD86-mediated costimulation of activated CD4+ T cells" .

When interpreting seemingly contradictory results, researchers should carefully document the experimental conditions, cell types, and molecular context to enable more accurate comparisons between studies.

What explains the discrepancy between predicted and observed molecular weight of recombinant CD86?

The predicted molecular weight of recombinant mouse B7-2 (CD86) is 51.8 kDa, but the actual molecular weight observed by migration on SDS-PAGE is typically 60-65 kDa . This discrepancy is common with glycoproteins and stems from several factors:

  • Post-translational modifications: CD86 undergoes extensive glycosylation, which adds considerable molecular weight beyond the amino acid sequence alone.

  • Expression system influence: Different expression systems (insect cells versus mammalian cells) may produce proteins with varying glycosylation patterns, affecting observed molecular weights.

  • Fusion tags: When CD86 is produced as an Fc fusion protein, the additional tag contributes to the molecular weight. The specific amino acid sequence provided in the search results indicates an Fc fusion construct .

Researchers should anticipate this molecular weight difference during experimental planning and interpret Western blot or SDS-PAGE results accordingly. Confirmation of protein identity through techniques such as mass spectrometry or N-terminal sequencing (search results indicate Val26 as the N-terminal residue) can provide additional validation.

What are emerging applications of CD86 in immunotherapy research?

CD86 is increasingly recognized as a potential target and biomarker in immunotherapy research. The association between CD86 and immune checkpoint molecules suggests several promising research directions:

  • Predictive biomarkers: Low CD86 expression has been identified as a potential predictive biomarker for clinical response to certain therapies . Further research may establish standardized measurement protocols and cutoff values for clinical application.

  • Combination therapies: The strong correlation between CD86 and CTLA4 (P < .001, r = 0.77) suggests that targeting both pathways simultaneously might enhance therapeutic efficacy. Research exploring CD86-targeted approaches in combination with established checkpoint inhibitors is warranted.

  • Tumor microenvironment modulation: CD86 appears to participate in immune invasion in AML and influences the tumor microenvironment . Strategies to modulate CD86 expression or function could potentially reshape the immune landscape within tumors.

  • Cell-specific targeting: The differential effects of CD86 on naive versus memory T cells suggest that selective targeting of CD86 interactions with specific cell populations could provide more precise immunomodulation with fewer off-target effects.

These emerging applications highlight the potential of CD86 as both a therapeutic target and a biomarker in next-generation immunotherapy development.

What methodological advances could enhance CD86 research?

Several methodological advances could significantly enhance CD86 research:

  • Single-cell analysis: Technologies enabling simultaneous assessment of CD86 expression and function at the single-cell level would provide unprecedented insights into cell-specific responses and heterogeneity.

  • In vivo imaging: Development of techniques to visualize CD86-mediated interactions in living organisms would enhance understanding of its dynamics in complex immune environments.

  • Structure-function studies: While the amino acid sequence of mouse CD86 is known , detailed structural analyses of CD86 interactions with binding partners could guide the development of more specific modulators.

  • Systems biology approaches: The complex correlation network involving CD86 and other immune molecules suggests that systems-level analyses would be beneficial for understanding CD86's role in broader immune regulation.

  • Standardized activity assays: Further refinement of biological activity assays, such as the IL-2 secretion assay with defined ED₅₀ ranges (0.05-0.15 μg/ml) , would enable more consistent comparison of results across different research groups.

These methodological advances would address current limitations in CD86 research and potentially accelerate the translation of fundamental insights into clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.