Recombinant Mouse Taste receptor type 2 member 106 (Tas2r106)

Shipped with Ice Packs
In Stock

Description

Production and Characterization of Recombinant Tas2r106

Recombinant Tas2r106 is produced using multiple expression systems for biochemical and immunological studies:

Expression Systems and Purification

Expression HostTagPurityFormSource
Mammalian cellsHis-tag>80%Liquid/lyophilized powder Creative Biomart
YeastNone>85%Lyophilized Cusabio
E. coliAviTag-BiotinN/ABiotinylated Cusabio
BaculovirusStrep-tagN/ALiquid Antibodies-Online

Production protocols emphasize endotoxin levels <1.0 EU/μg and stability across storage conditions (-80°C for long-term) .

Bitter Taste Perception

  • Tas2r106 is expressed in mouse vallate papillae taste cells, though at lower levels compared to other Tas2rs like Tas2r118 .

  • Unlike human TAS2Rs, mouse Tas2r106 shows distinct agonist selectivity, responding to bitter compounds critical for murine ecological niches .

Immune Modulation

  • Neutrophils express Tas2r106 alongside Tas2r126/143, where it enhances CXCL2-stimulated migration via ROCK-dependent phosphorylation of myosin light chain 2 (MLC2) .

  • Knockout studies in Tas2r126/135/143−/− mice confirm abolished neutrophil migration responses to bitter agonists like arbutin .

Research Applications

Recombinant Tas2r106 is utilized in:

  1. Ligand Screening: Identifying bitter compounds via calcium flux assays in heterologous cell systems .

  2. Immune Studies: Investigating neutrophil chemotaxis mechanisms using in vitro migration assays .

  3. Structural Biology: Mapping transmembrane domain interactions using tagged protein variants .

Comparative Insights

Mouse Tas2r106 exhibits functional divergence from human orthologs:

ParameterMouse Tas2r106Human Ortholog
Agonist breadthNarrow tuning Broader tuning (e.g., TAS2R38)
Immune cell roleNeutrophil migration enhancement Limited evidence
Expression levelLow in taste papillae Moderate in extraoral tissues

Challenges and Future Directions

Current limitations include incomplete agonist profiling and lack of high-resolution structural data. Advances in cryo-EM and organoid models could elucidate Tas2r106’s role in taste-immune crosstalk .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipment is required, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Tas2r106; T2r44; Taste receptor type 2 member 106; T2R106; mT2R44
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tas2r106
Target Protein Sequence
MLTVAEGILLCFVTSGSVLGVLGNGFILHANYINCVRKKFSTAGFILTGLAICRIFVICI IISDGYLKLFSPHMVASDAHIIVISYIWVIINHTSIWFATSLNLFYLLKIANFSHYIFFC LKRRINTVFIFLLGCLFISWSIAFPQTVKIFNVKKQHRNVSWQVYLYKNEFIVSHILLNL GVIFFFMVAIITCFLLIISLWKHNRKMQLYASRFKSLNTEVHVKVMKVLISFIILLILHF IGILIETLSFLKYENKLLLILGLIISCMYPCCHSFILILANSQLKQASLKALKQLKCHKK DKDVRVTW
Uniprot No.

Target Background

Function
This protein is a putative taste receptor that might play a role in the perception of bitterness.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tas2r106 and how is it classified among mouse bitter taste receptors?

Tas2r106 belongs to the Tas2r family of G protein-coupled receptors that mediate bitter taste perception in mice. These receptors are expressed in taste receptor cells located primarily in the posterior papillae of the mouse tongue. Mouse Tas2r genes vary in their expression levels, with some being highly abundant (like Tas2r108, Tas2r118, Tas2r126, Tas2r135, and Tas2r137) while others are expressed at lower levels . Tas2r106 is one of approximately 35 putatively functional bitter taste receptors in mice that collectively enable recognition of diverse bitter compounds .

How can I detect Tas2r106 expression in mouse taste tissue?

Tas2r106 expression can be detected using quantitative RT-PCR (qRT-PCR) and in situ hybridization techniques. For qRT-PCR, RNA should be isolated from posterior tongue epithelium, converted to cDNA, and amplified using Tas2r106-specific primers. Results are typically normalized to housekeeping genes or to α-gustducin levels as demonstrated in studies of other Tas2r genes . For in situ hybridization, tongue tissue sections (particularly vallate papillae) should be processed with Tas2r106-specific probes, with appropriate sense probes as negative controls. Visualization can be accomplished through standard colorimetric or fluorescence methods, with signal intensity variations observed among different Tas2r genes reflecting their relative expression levels .

What is the typical expression pattern of Tas2r106 compared to other Tas2r genes?

While the search results don't specifically mention Tas2r106 expression patterns, studies of the mouse Tas2r family show significant variation in expression levels. Some receptors like Tas2r118 are detected in many taste cells with strong signal intensity, while others like Tas2r120 or Tas2r102 are rarely expressed with faint staining . The expression pattern of Tas2r106 would need to be determined through specific qRT-PCR analysis and in situ hybridization studies. Data from related Tas2r genes suggests it may have a distinct expression profile that contributes to the heterogeneous bitter taste receptor cell population in mouse gustatory tissue .

What experimental systems are most effective for studying Tas2r106 activation?

For functional characterization of Tas2r106, heterologous expression systems using HEK293T cells represent the gold standard. The most sensitive approach involves cells stably expressing the chimeric G protein Gα16gust44, which couples bitter taste receptors to calcium signaling pathways. This system has proven more sensitive than Gα15-based assays for detecting responses of other mouse Tas2r receptors . Transfection of Tas2r106 expression constructs into these cells, followed by calcium imaging assays using fluorescent calcium indicators (e.g., Fluo-4), allows for quantitative measurement of receptor activation in response to potential agonists. This approach enables determination of both efficacy (maximum response amplitude) and potency (EC50 values) of various compounds .

How should I design a calcium imaging assay to screen for Tas2r106 agonists?

A comprehensive calcium imaging assay for Tas2r106 should follow these methodological steps:

  • Cell preparation: Transfect HEK293T cells stably expressing Gα16gust44 with Tas2r106 expression constructs.

  • Plate cells in imaging-compatible formats (96-well plates or coverslips) 24-48 hours prior to assay.

  • Load cells with calcium-sensitive dye (e.g., Fluo-4 AM) for 1 hour.

  • Establish baseline fluorescence before compound addition.

  • Prepare test compounds at multiple concentrations (typically 1-300 μM) in assay buffer.

  • Add compounds and monitor changes in fluorescence intensity.

  • Quantify responses as relative fluorescence change (ΔF/F).

  • Include positive controls (known bitter compounds) and negative controls (buffer alone).

  • Generate concentration-response curves to determine threshold concentrations and EC50 values.

  • Validate findings with repeated independent experiments .

This methodological approach has successfully identified agonists for multiple mouse Tas2r receptors and can be applied to characterize Tas2r106 activation profiles .

What are the main considerations for experimental design when studying Tas2r106 specificity?

When designing experiments to characterize Tas2r106 specificity, researchers should consider:

  • Compound selection: Test a diverse panel of bitter compounds (>100 compounds) from different structural classes to determine receptor tuning breadth.

  • Concentration range: Evaluate compounds across a wide concentration range (typically 0.1-1000 μM) to establish both threshold concentrations and EC50 values.

  • Experimental controls: Include known bitter taste receptor agonists as positive controls and empty vector-transfected cells as negative controls.

  • Receptor specificity: Test the same compound panel across multiple Tas2r receptors to identify Tas2r106-specific agonists versus shared agonists.

  • Statistical approach: Use appropriate statistical methods for concentration-response analysis, such as nonlinear regression with variable slope parameters.

  • Experimental design: Implement within-subjects design (testing all compounds on the same batch of transfected cells) to minimize variability .

These considerations ensure robust characterization of Tas2r106 specificity profiles while minimizing experimental artifacts.

How does Tas2r106 compare functionally to other mouse bitter taste receptors in terms of tuning breadth?

Mouse bitter taste receptors demonstrate considerable variation in their tuning breadth, ranging from specialists that recognize few compounds to generalists that respond to many bitter substances. For example, Tas2r105 functions as a generalist receptor responding to >30% of tested bitter compounds, while other Tas2r receptors have narrower response profiles .

To determine Tas2r106's tuning breadth, researchers should:

  • Systematically test Tas2r106 against a comprehensive bitter compound library (>100 compounds)

  • Compare response profiles with other characterized mouse Tas2r receptors

  • Calculate the percentage of active compounds from the test library

  • Classify Tas2r106 as specialist, intermediate, or generalist based on its activation profile

Functional orthology between Tas2r106 and related receptors in other species should also be evaluated to understand evolutionary relationships and potential specialized roles in detecting compounds of species-specific relevance .

What are the approaches for correlating Tas2r106 in vitro responses with behavioral taste perception in mice?

To establish correlations between Tas2r106 activation in vitro and behavioral responses in mice, researchers should implement a multi-level experimental approach:

  • In vitro characterization:

    • Identify specific Tas2r106 agonists through heterologous expression systems

    • Determine potency (EC50) and efficacy (maximum response) parameters

    • Identify Tas2r106-specific compounds not activating other Tas2r receptors

  • Behavioral testing:

    • Conduct brief-access taste tests using compounds identified as Tas2r106 agonists

    • Implement two-bottle preference tests at multiple concentrations

    • Compare wild-type mice with Tas2r106 knockout models

  • Data analysis:

    • Calculate correlation coefficients between in vitro potency values and behavioral aversion thresholds

    • Perform regression analysis between receptor activation parameters and behavioral metrics

    • Compare behavioral responses to Tas2r106-specific versus broadly-activating compounds

This comprehensive approach allows researchers to determine whether Tas2r106 activation is necessary and/or sufficient for behavioral aversion to specific bitter compounds.

What methodologies can identify potential endogenous agonists for Tas2r106?

Identifying endogenous agonists for Tas2r106 requires a strategic research approach:

  • Bioinformatic screening:

    • Analyze structural similarities between known Tas2r agonists

    • Use computational modeling to predict binding of endogenous molecules

    • Screen databases of endogenous metabolites for structural compatibility

  • Biological sample testing:

    • Prepare extracts from relevant tissues (tongue, gastrointestinal tract)

    • Fractionate extracts using HPLC or other separation techniques

    • Test fractions for Tas2r106 activation in heterologous expression systems

    • Identify active components through mass spectrometry

  • Validation studies:

    • Synthesize or obtain purified candidate compounds

    • Confirm direct activation of Tas2r106 in dose-dependent manner

    • Conduct structure-activity relationship studies with analogs

    • Verify physiological relevance through measurement of endogenous concentrations

Studies of other Tas2r receptors have identified physiologically relevant compounds such as bacterial quorum-sensing molecules (N-acyl homoserine lactones) that specifically activate certain receptors (e.g., Tas2r105), suggesting similar approaches may reveal endogenous agonists for Tas2r106 .

What are the most effective approaches for generating Tas2r106 knockout or reporter mouse models?

Generating Tas2r106 genetic models requires careful consideration of taste receptor biology:

  • CRISPR/Cas9 genome editing:

    • Design guide RNAs targeting unique regions of Tas2r106

    • Introduce early stop codons or frameshift mutations to disrupt function

    • Verify knockout through sequencing and expression analysis

    • Consider potential compensation by other Tas2r genes

  • Reporter gene knock-in strategies:

    • Replace Tas2r106 coding sequence with fluorescent reporters (GFP, mCherry)

    • Use self-cleaving peptides (T2A) to maintain Tas2r106 expression while enabling visualization

    • Implement Cre-recombinase systems for conditional expression

  • Validation approaches:

    • Confirm loss of Tas2r106 mRNA by qRT-PCR

    • Verify absence of protein through immunohistochemistry

    • Conduct functional assays using identified Tas2r106-specific agonists

    • Perform behavioral tests to assess phenotypic consequences

These genetic models are essential tools for investigating Tas2r106's specific role within the broader bitter taste reception system.

How can structure-function relationships be investigated for Tas2r106?

Structure-function analysis of Tas2r106 requires systematic molecular approaches:

  • Comparative sequence analysis:

    • Align Tas2r106 with functionally characterized Tas2r receptors

    • Identify conserved and divergent regions that may influence ligand specificity

    • Compare with human TAS2R orthologs with known structure-function relationships

  • Site-directed mutagenesis:

    • Target predicted ligand-binding domains or G-protein coupling regions

    • Create point mutations at conserved residues in transmembrane domains

    • Develop chimeric receptors between Tas2r106 and receptors with different agonist profiles

  • Functional characterization:

    • Express mutant receptors in heterologous systems

    • Test activation by previously identified agonists

    • Quantify changes in efficacy and potency (EC50 values)

    • Identify mutations that alter receptor activation properties

This systematic approach can reveal critical residues for agonist recognition and provide insights into the molecular determinants of Tas2r106 function.

What factors should be considered when designing a full factorial experiment involving Tas2r106?

When designing a full factorial experiment to investigate Tas2r106, researchers should consider:

  • Factor selection:

    • Independent variables: compound type, concentration, receptor variant

    • Dependent variables: calcium response amplitude, EC50 values, activation kinetics

  • Experimental conditions:

    • Between-subjects vs. within-subjects design

    • Number of experimental conditions (design cells)

    • Sample size per condition

  • Statistical power considerations:

    • Effect size estimation based on preliminary data

    • Power analysis to determine necessary replication

    • Appropriate statistical tests for data analysis

For example, a 3×2 full factorial design might investigate three agonist concentrations and two receptor variants (wild-type vs. mutant), resulting in six experimental conditions. Sample size should be determined based on expected effect sizes and desired statistical power .

How can I determine the appropriate sample size for Tas2r106 functional studies?

Determining appropriate sample size for Tas2r106 functional studies involves several methodological considerations:

  • Statistical power calculation:

    • Estimate effect size based on preliminary data or literature

    • Set desired statistical power (typically 0.8 or higher)

    • Determine type I error rate (typically α = 0.05)

    • Calculate minimum sample size using power analysis software

  • Study design factors:

    • Between-subjects design requires more samples than within-subjects design

    • Consider variability in transfection efficiency and receptor expression

    • Account for technical replicates vs. biological replicates

  • Practical approach:

    • For concentration-response curves, minimum of 3-4 independent experiments

    • For screening assays, 3 replicates per compound

    • For critical threshold determination, 6-8 replicates recommended

Proper sample size estimation ensures reliable detection of biologically meaningful effects while optimizing resource utilization.

What statistical approaches are most appropriate for analyzing Tas2r106 activation data?

Analyzing Tas2r106 activation data requires tailored statistical approaches:

  • Concentration-response analysis:

    • Nonlinear regression using four-parameter logistic model

    • Determination of EC50 values with 95% confidence intervals

    • Comparison of curve parameters across experiments or conditions

    • Statistical tests for differences in potency or efficacy

  • Compound comparison:

    • ANOVA with post-hoc tests for multiple compound comparisons

    • Hierarchical clustering of compounds based on activation profiles

    • Principal component analysis to identify response patterns

  • Data presentation:

    • Normalized response data (ΔF/F or % of maximum)

    • Standardized quantification of threshold concentrations

    • Statistical significance indicators for differential responses

These approaches enable rigorous comparison of Tas2r106 responses to various compounds and conditions.

How can I distinguish between specific and non-specific responses in Tas2r106 functional assays?

Distinguishing specific from non-specific responses in Tas2r106 functional assays requires careful experimental controls and analytical approaches:

  • Essential controls:

    • Empty vector-transfected cells to identify receptor-independent responses

    • Mock-transfected cells to control for transfection reagent effects

    • Vehicle controls to account for solvent effects

    • Positive controls with known bitter receptor agonists

  • Analytical methods:

    • Statistical comparison between test and control responses

    • Signal-to-background ratio calculation

    • Concentration-dependence analysis (specific responses typically show dose-dependence)

    • Response kinetics analysis (specific responses often have distinct temporal profiles)

  • Validation approaches:

    • Receptor antagonist studies where available

    • Confirmation with multiple independent assay methods

    • Comparison with structurally related inactive compounds

These methodological approaches minimize false positives and ensure identification of genuine Tas2r106 agonists.

How can I incorporate Tas2r106 into broader studies of taste receptor signaling networks?

Incorporating Tas2r106 into systems-level analyses of taste receptor signaling requires integrative approaches:

  • Co-expression studies:

    • Analyze co-expression patterns with other Tas2r receptors in single taste cells

    • Investigate co-expression with signaling components (α-gustducin, PLCβ2, TRPM5)

    • Implement single-cell RNA sequencing to identify Tas2r106-expressing cell populations

  • Signaling pathway analysis:

    • Investigate G-protein coupling specificity of Tas2r106

    • Compare downstream calcium signaling kinetics with other Tas2r receptors

    • Examine potential cross-talk with other taste modalities

  • Network modeling approaches:

    • Construct mathematical models of bitter taste receptor activation patterns

    • Integrate Tas2r106 responses into predictive models of bitter taste perception

    • Analyze receptor-compound interaction networks to identify structural determinants of activation

These approaches position Tas2r106 studies within the broader context of taste perception and signaling networks.

What methodologies enable investigation of Tas2r106 expression in non-gustatory tissues?

Investigating Tas2r106 expression in non-gustatory tissues requires specialized techniques:

  • Sensitive detection methods:

    • Digital droplet PCR for absolute quantification of low-abundance transcripts

    • RNA-seq with sufficient depth to detect low-expression genes

    • Nested PCR approaches for increased sensitivity

  • Tissue preparation considerations:

    • Careful dissection and separation of target tissues

    • Enrichment of specific cell populations through FACS or other methods

    • Preservation techniques to maintain RNA integrity

  • Comparative analysis:

    • Quantitative comparison with gustatory expression levels

    • Relative abundance compared to other Tas2r family members

    • Correlation with expression of bitter taste signaling components

Studies have demonstrated Tas2r expression in various non-gustatory tissues such as testis and heart, with expression patterns differing from those observed in taste papillae . Similar approaches can reveal potential extra-oral functions of Tas2r106.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.