Recombinant Mouse Taste receptor type 2 member 107 (Tas2r107)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tas2r107; T2r4; T2r43; Taste receptor type 2 member 107; T2R107; mT2R43; STC5-1; T2R4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tas2r107
Target Protein Sequence
MLNSAEGILLCVVTSEAVLGVLGDTYIALFNCMDYAKNKKLSKIGFILIGLAISRIGVVW IIILQGYIQVFFPHMLTSGNITEYITYIWVFLNHLSVWFVTNLNILYFLKIANFSNSVFL WLKRRVNAVFIFLSGCLLTSWLLCFPQMTKILQNSKMHQRNTSWVHQRKNYFLINQSVTN LGIFFFIIVSLITCFLLIVFLWRHVRQMHSDVSGFRDHSTKVHVKAMKFLISFMVFFILH FVGLSIEVLCFILPQNKLLFITGLTATCLYPCGHSIIVILGNKQLKQASLKALQQLKCCE TKGNFRVK
Uniprot No.

Target Background

Function
Putative taste receptor that may play a role in the perception of bitterness.
Gene References Into Functions
  1. Data suggest that Tas2r107 is expressed on murine airway smooth muscle (ASM) cells. Tas2r107 agonists reverse bronchoconstriction by inhibiting agonist-induced calcium oscillations while simultaneously reducing calcium sensitivity of ASM cells. PMID: 24117140
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tas2r107 and what is its role in the mouse taste system?

Tas2r107 is a member of the Taste receptor type 2 (Tas2r) family in mice, which functions as a G protein-coupled receptor responsible for detecting bitter compounds. It belongs to the repertoire of 35 putatively functional bitter taste receptors identified in mice. These receptors are primarily expressed in taste buds located in gustatory papillae and mediate aversive responses to potentially harmful substances. The Tas2r family in mice shows considerable diversity, reflecting evolutionary adaptations to detect a wide range of bitter compounds that may be harmful to the organism .

How is Tas2r107 expressed in mouse taste tissues?

Tas2r107, like other mouse Tas2r genes, is expressed in gustatory tissues, particularly in taste receptor cells within taste buds. Expression studies using in situ hybridization and quantitative RT-PCR techniques have demonstrated that mouse Tas2r genes, including Tas2r107, are expressed at varying levels in taste epithelium. This variation in expression contributes to the heterogeneity of bitter taste receptor cell populations in mice. While some Tas2r genes show robust expression in lingual papillae, others exhibit lower expression levels, creating a complex pattern of bitter taste detection mechanisms .

How do researchers functionally characterize Tas2r107?

Functional characterization of Tas2r107 typically involves heterologous expression systems where the receptor is expressed in cell lines such as HEK293T cells. Researchers transfect these cells with constructs encoding Tas2r107 along with components needed for signal transduction, such as G proteins. The cells are then exposed to potential bitter compounds, and receptor activation is measured using calcium imaging or other signaling assays. Through this approach, researchers can identify specific agonists that activate Tas2r107 and determine the receptor's tuning properties and response characteristics. This methodology has been successfully applied to characterize multiple mouse Tas2r receptors in comprehensive screening studies .

What are the optimal expression systems for studying recombinant Tas2r107?

For studying recombinant Tas2r107, researchers typically use mammalian cell expression systems, particularly HEK293T cells, which provide an appropriate cellular environment for proper receptor folding and trafficking. When establishing an expression system for Tas2r107, it's important to consider using specialized expression vectors that enhance surface expression, as bitter taste receptors often show poor trafficking to the plasma membrane in heterologous systems. This may include the use of N-terminal epitope tags or fusion with rhodopsin sequences to facilitate receptor trafficking. Additionally, co-expression with chimeric or promiscuous G proteins (such as Gα16gust44) is often necessary to couple the receptor to calcium signaling pathways that can be measured experimentally. The optimization of transfection conditions, including DNA concentration ratios between receptor and G protein constructs, is crucial for achieving reliable functional responses .

How can researchers design comprehensive screening assays for identifying Tas2r107 agonists?

Designing comprehensive screening assays for Tas2r107 agonists requires a methodical approach similar to what has been applied to other Tas2r receptors. Researchers should:

  • Establish a stable heterologous expression system with optimal receptor surface expression

  • Develop a diverse compound library containing known bitter substances with varied chemical structures

  • Implement high-throughput functional assays (e.g., calcium imaging, FLIPR)

  • Use appropriate positive and negative controls to validate assay performance

  • Include dose-response analyses for active compounds to determine potency (EC50 values)

A thorough screening approach should include both natural and synthetic bitter compounds, encompassing different chemical classes such as alkaloids, polyphenols, glycosides, and amino acids. Based on studies with other mouse Tas2r receptors, a collection of at least 100 diverse compounds represents a good starting point for comprehensive agonist profiling. Researchers should also consider compounds that have shown activity at other Tas2r receptors, as many bitter compounds can activate multiple receptors with varying potencies .

What are the most effective methods for validating putative Tas2r107 agonists?

Validating putative Tas2r107 agonists requires a multi-faceted approach combining in vitro functional assays with behavioral studies. Effective validation methods include:

  • Dose-response analyses to establish concentration-dependent activation profiles

  • Receptor specificity testing against other Tas2r family members

  • Structure-activity relationship studies with chemical analogs

  • Receptor mutagenesis to identify critical binding residues

  • Comparison with behavioral responses in brief-access taste tests

  • Knockout validation using Tas2r107-deficient mice to confirm receptor-specific effects

For rigorous validation, compounds showing activity in initial screening should be tested in at least three independent experiments with technical replicates. Additionally, comparing the pharmacological profiles of mouse Tas2r107 with human orthologues can provide valuable insights into species-specific differences in bitter taste perception. This comparative approach has proven valuable in understanding the evolutionary and functional divergence of bitter taste receptors across species .

How does Tas2r107 compare functionally with human bitter taste receptors?

For example, broadly tuned human receptors like TAS2R10, TAS2R14, and TAS2R46 respond to numerous compounds across different chemical classes. The mouse Tas2r repertoire shows more specialization, with many receptors exhibiting narrower tuning properties. These differences likely reflect adaptations to different ecological niches and dietary patterns between species. When developing translational studies, researchers must consider these functional differences, as findings from mouse models may not directly translate to human bitter taste perception .

What role does Tas2r107 play in taste disorders and potential therapeutic applications?

Tas2r107's role in taste disorders remains an active area of investigation. While specific information about Tas2r107 in taste disorders is limited, studies on taste receptor systems provide valuable insights. For instance, oxaliplatin, a platinum-based anticancer drug, induces taste disorders in cancer patients. In rat models, oxaliplatin administration led to altered expression of taste receptors, particularly sweet taste receptors like T1R2, which showed increased expression in circumvallate papillae despite decreased behavioral responses to sweet taste .

By analogy, changes in Tas2r107 expression or function might contribute to bitter taste alterations in pathological conditions or drug-induced taste disorders. Understanding these mechanisms could inform potential therapeutic strategies. Taste receptors, including Tas2r107, might serve as targets for developing taste modifiers to mask bitter tastes of medications or to treat taste disorders. Moreover, as bitter taste receptors are expressed in extra-oral tissues, Tas2r107 might have additional physiological roles beyond taste perception, opening avenues for novel therapeutic applications in conditions affecting these tissues .

What are the current challenges in expressing and purifying functional recombinant Tas2r107 protein?

Expression and purification of functional recombinant Tas2r107 protein present significant technical challenges common to G protein-coupled receptors (GPCRs). These challenges include:

  • Poor surface expression in heterologous systems due to inefficient trafficking

  • Instability of the receptor protein outside the membrane environment

  • Requirement for specific lipid compositions for maintaining native conformation

  • Difficulty in obtaining sufficient protein yields for structural studies

  • Potential interference of purification tags with receptor function

  • Challenges in reconstituting the receptor in functional assay systems after purification

To address these challenges, researchers can employ strategies similar to those used for other recombinant proteins, such as optimization of expression conditions, use of specialized expression vectors, and development of purification protocols that maintain protein stability. For instance, approaches used for recombinant mouse IFN-gamma protein production in E. coli expression systems might be adapted for Tas2r107, with appropriate modifications accounting for the membrane protein nature of the receptor .

Advanced techniques such as insertion of thermostabilizing mutations, use of detergent micelles or nanodiscs for membrane protein stabilization, and development of conformationally selective antibodies can facilitate purification of functional receptor protein. These approaches are essential for structural studies and for developing in vitro binding assays to directly characterize ligand interactions with Tas2r107 .

How should researchers interpret dose-response data for Tas2r107 activation?

When interpreting dose-response data for Tas2r107 activation, researchers should consider several important factors:

  • EC50 values and potency ranking: Calculate half-maximal effective concentration (EC50) values to rank compounds by potency. Lower EC50 values indicate higher potency.

  • Maximum response (Emax): Analyze whether compounds act as full or partial agonists based on their maximum response levels relative to reference compounds.

  • Hill coefficient: Evaluate the steepness of the dose-response curve, which can provide insights into receptor-ligand binding cooperativity.

  • Response variability: Consider biological and technical variability, using appropriate statistical methods to determine confidence intervals for EC50 values.

  • Receptor expression levels: Normalize responses to receptor expression levels when comparing across experiments or cell lines.

The table below illustrates how dose-response data might be presented for hypothetical Tas2r107 agonists:

CompoundEC50 (μM)95% CI (μM)Hill CoefficientEmax (% of reference)
Compound A12.38.7-17.51.2100
Compound B45.632.1-64.80.985
Compound C3.52.8-4.31.570
Quinine25.718.3-36.21.195

When interpreting such data, researchers should compare results with those obtained for other mouse Tas2r receptors and consider how the pharmacological profiles align with behavioral responses observed in brief-access taste tests. This integrated analysis approach helps connect molecular mechanisms to physiological outcomes .

How can researchers address data contradictions between in vitro Tas2r107 assays and in vivo taste preference studies?

Contradictions between in vitro Tas2r107 activation data and in vivo taste preference studies can arise from multiple factors. To address these contradictions, researchers should:

  • Examine receptor expression context: In heterologous systems, Tas2r107 exists in isolation, while in vivo it is expressed alongside other taste receptors in specialized cells with specific signaling machinery.

  • Consider signal integration: In vivo taste perception involves integration of signals from multiple receptors and taste modalities at both peripheral and central levels.

  • Analyze bitter taste masking: Other taste modalities (sweet, umami) can mask bitter taste perception in behavioral studies.

  • Evaluate pharmacokinetic factors: Compound bioavailability, metabolism, and clearance in behavioral tests may differ from controlled in vitro conditions.

  • Develop correlated assays: Design experiments that directly correlate receptor activation with behavioral responses using the same compounds at equivalent concentrations.

For example, studies with other Tas2r receptors have shown that compounds activating these receptors in vitro don't always elicit proportional aversive responses in vivo. Systematic comparison of EC50 values from calcium imaging assays with concentration thresholds for behavioral aversion can help identify discrepancies. When contradictions occur, researchers should consider using genetic models (receptor knockouts) to definitively link specific receptors to behavioral outcomes .

What statistical approaches are recommended for analyzing Tas2r107 agonist screening data?

For analyzing Tas2r107 agonist screening data, researchers should employ robust statistical approaches that account for the specific characteristics of receptor activation assays. Recommended statistical methods include:

  • Z-factor analysis for assessing assay quality and robustness in high-throughput screening

  • Normalization strategies to account for variations in receptor expression or assay conditions

  • Non-linear regression for fitting dose-response curves (preferably using four-parameter logistic models)

  • ANOVA with post-hoc tests for comparing responses across multiple compounds

  • False discovery rate control when screening large compound libraries

  • Principal component analysis for identifying patterns in receptor responses across compound classes

When analyzing screening data for Tas2r107 and other Tas2r receptors, it's important to establish appropriate thresholds for declaring "hits." A common approach is to define compounds as active if they elicit responses exceeding three standard deviations above baseline or negative control responses.

The following data representation example illustrates how screening results might be summarized:

Compound CategoryNumber TestedNumber Active at Tas2r107Active at Multiple Tas2rTas2r107-Selective
Alkaloids28862
Phenolic compounds32550
Amino acids/peptides15211
Terpenoids18743
Glucosinolates12330
Synthetic compounds23633

This statistical approach enables researchers to identify both broadly tuned and receptor-specific bitter compounds, contributing to our understanding of the molecular basis of bitter taste perception .

What are the key knowledge gaps in Tas2r107 research that require further investigation?

Despite advances in understanding mouse bitter taste receptors, several critical knowledge gaps in Tas2r107 research remain to be addressed:

Addressing these knowledge gaps will require integrative approaches combining molecular, cellular, and behavioral methods to comprehensively understand the role of Tas2r107 in mouse physiology.

How might CRISPR-Cas9 technology be leveraged to study Tas2r107 function?

CRISPR-Cas9 technology offers powerful approaches for studying Tas2r107 function through precise genetic manipulation. Researchers can leverage this technology in several ways:

  • Generation of receptor knockouts: Creating Tas2r107-deficient mice to assess the specific contribution of this receptor to bitter taste perception and avoidance behaviors.

  • Knock-in reporter systems: Introducing fluorescent reporters or epitope tags to the endogenous Tas2r107 locus to monitor expression patterns and protein localization without disrupting native regulation.

  • Point mutations: Engineering specific amino acid substitutions to study structure-function relationships and identify critical residues for ligand binding and receptor activation.

  • Humanized receptor models: Replacing mouse Tas2r107 with human orthologs to create transgenic models for studying species differences in bitter taste perception.

  • Conditional expression systems: Developing tissue-specific or inducible Tas2r107 expression models to study spatiotemporal aspects of receptor function.

When designing CRISPR-Cas9 strategies for Tas2r107, researchers should carefully consider potential off-target effects and include appropriate controls to validate the specificity of observed phenotypes. For behavioral studies, comparisons between knockout and wild-type littermates under identical testing conditions are essential to attribute phenotypic differences specifically to Tas2r107 function .

What emerging technologies show promise for advancing Tas2r107 research?

Several emerging technologies show significant promise for advancing Tas2r107 research:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized GPCR structural biology and could potentially resolve the structure of Tas2r107 in different conformational states, providing crucial insights into activation mechanisms.

  • Single-cell transcriptomics: Advanced single-cell RNA sequencing can reveal the heterogeneity of Tas2r107 expression among taste receptor cells and identify co-expression patterns with other receptors and signaling components.

  • Organoid models: Taste bud organoids derived from stem cells could provide physiologically relevant systems for studying Tas2r107 function in a controlled environment that better mimics native taste buds.

  • Optogenetic and chemogenetic tools: These approaches allow precise temporal control of Tas2r107-expressing cells, enabling researchers to dissect the contribution of specific receptor populations to taste perception and behavior.

  • Advanced imaging techniques: Methods such as super-resolution microscopy and calcium imaging with genetically encoded indicators can provide new insights into Tas2r107 localization and signaling dynamics in real-time.

  • Computational modeling and AI-driven drug design: These approaches can predict potential Tas2r107 agonists based on structural features and guide the development of receptor-specific compounds for experimental validation.

The integration of these technologies with traditional approaches will accelerate our understanding of Tas2r107 function and potentially reveal novel applications in fields ranging from taste modulation to drug discovery .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.