Recombinant Mouse Taste receptor type 2 member 114 (Tas2r114)

Shipped with Ice Packs
In Stock

Description

Key Features:

PropertyDetails
Gene SynonymsmGR14, mt2r46, T2R14, Tas2r14
Protein Length309 amino acids (UniProt ID: Q7M722)
ORF Size927 bp (RefSeq: NM_207019.1)
Expression SystemsMammalian cells (e.g., HEK293), E. coli, AAV vectors
Structural Domains7-transmembrane GPCR architecture with extracellular ligand-binding domains

Research Applications and Production Methods

Recombinant Tas2r114 is utilized to investigate bitter ligand interactions, signaling pathways, and roles in non-gustatory tissues.

Production Platforms:

  • AAV Vectors: Available in serotypes AAV1, AAV2, AAV8, and synthetic capsids with optional fluorescent reporters (e.g., GFP, mCherry) .

  • Mammalian Systems: HEK293 cells for functional studies requiring post-translational modifications .

  • Bacterial Systems: E. coli for cost-effective bulk production of His-tagged proteins .

Example Construct:

ComponentDetails
PromoterCMV (default) or tissue-specific promoters
StoragePBS buffer with 5% glycerol

Ligand Specificity and Signaling

Tas2r114 responds to structurally diverse bitter compounds, including:

AgonistEfficacy (ΔF/F)Role in SignalingReference
Cucurbitacins (B, D)High (~1.0)Anti-inflammatory and cytotoxic
DiphenidolModerate (0.5)Bitter taste transduction
PhenanthrolineModerate (0.4)Metal chelation and bitterness
  • Tas2r114 activation triggers Gα-gustducin signaling, leading to intracellular calcium release and neuronal activation .

Extraoral Expression and Physiological Roles

  • Respiratory System: Modulates mucosal immune responses .

  • Detrusor Smooth Muscle (DSM): Regulates bladder relaxation in mice .

  • Testis: Exhibits robust expression, suggesting roles in reproductive health .

Cryo-EM Studies

While direct structural data for mouse Tas2r114 is limited, its human homolog TAS2R14 (sharing ~60% homology) reveals:

  • Dual Binding Sites: Flufenamic acid (FFA) binds both transmembrane and intracellular pockets to stabilize receptor-gustducin interactions .

  • Therapeutic Potential: Polymorphisms in Tas2r114 correlate with altered drug metabolism and cancer survival rates .

Genetic Knockout Models

  • Tas2r114 Mutants: Show reduced sensitivity to cucurbitacin B (CuB) and impaired bitter taste signaling .

Disease Associations

ConditionObserved EffectReference
CancerOverexpression linked to apoptosis in pancreatic adenocarcinoma
InflammationFFA-Tas2r114 interaction reduces inflammatory markers

Future Directions

Ongoing research aims to:

  1. Map Tas2r114’s role in non-taste tissues using CRISPR/Cas9 models .

  2. Develop Tas2r114-targeted therapies for inflammatory diseases and cancer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Tas2r114; T2r46; Taste receptor type 2 member 114; T2R114; mT2R46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tas2r114
Target Protein Sequence
MLSTMEGVLLSVSTSEAVLGIVGNTFIALVNCMDYNRNKKLSNIGFILTGLAISRICLVL ILITEAYIKIFYPQLLSPVNIIELISYLWIIICQLNVWFATSLSIFYFLKIANFSHYIFV WLKRRIDLVFFFLIGCLLISWLFSFPVVAKMVKDNKMLYINTSWQIHMKKSELIINYVFT NGGVFLFFMIMLIVCFLLIISLWRHRRQMESNKLGFRDLNTEVHVRTIKVLLSFIILFIL HFMGITINVICLLIPESNLLFMFGLTTAFIYPGCHSLILILANSRLKQCSVMILQLLKCC ENGKELRDT
Uniprot No.

Target Background

Function
Putative taste receptor potentially involved in bitterness perception.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the expression profile of Tas2r114 in mouse taste tissues?

Tas2r114 is expressed in the epithelium of the posterior tongue, particularly in vallate papillae. Quantitative RT-PCR analyses have demonstrated that Tas2r114 mRNA is present at relatively low levels compared to other Tas2r family members, just reaching detection thresholds in standard assays. While some Tas2r receptors such as Tas2r108, Tas2r118, Tas2r126, Tas2r135, and Tas2r137 show high expression (approximately 20% of α-gustducin mRNA levels), Tas2r114 belongs to the group of rarely expressed receptors along with Tas2r122 and Tas2r140 . This expression pattern has been confirmed through in situ hybridization experiments on mouse vallate papillae sections, which reveal cell-specific differences in expression levels among various Tas2r receptors .

How does Tas2r114 function within the bitter taste receptor family?

Tas2r114 functions as a G protein-coupled receptor (GPCR) specifically involved in bitter taste sensation. Like other Tas2r family members, it likely signals through a common pathway involving gustducin and phospholipase C-β2, ultimately leading to calcium release and action potential generation in taste receptor cells. The receptor is expected to respond to specific bitter compounds, though its exact ligand profile has been less extensively characterized compared to other mouse Tas2rs such as Tas2r105 (which responds to cycloheximide) and Tas2r108 (which responds to denatonium benzoate and PROP) . The full functional characterization of Tas2r114 remains an active area of research, especially considering its lower expression levels which might indicate specialized detection of particular bitter compounds relevant to mouse ecological niches.

What is the genetic structure of the Tas2r114 gene?

The Tas2r114 gene belongs to the Tas2r family in mice. While the search results don't provide specific information about the Tas2r114 gene structure, most Tas2r genes share a common architectural feature: they are intronless, containing their entire coding sequence within a single exon. The mouse genome contains approximately 35 putatively functional Tas2r genes , with Tas2r114 being one of them. The gene is likely located in one of the bitter taste receptor gene clusters in the mouse genome. Like other taste receptor genes, Tas2r114 has evolved through processes of gene duplication, deletion, and pseudogenization that have shaped the varying number of taste receptor genes across different vertebrate species.

What experimental approaches are most effective for studying Tas2r114 function?

Given the low expression levels of Tas2r114, robust experimental approaches must be employed to study its function:

Heterologous Expression Assays:
The most effective approach for determining Tas2r114 ligand specificity involves heterologous expression systems. This method has been successfully employed to characterize other mouse Tas2r receptors . The protocol typically involves:

  • Cloning the full-length Tas2r114 coding sequence into an expression vector

  • Transfecting the construct into a cell line that does not endogenously express bitter taste receptors (commonly HEK293T cells)

  • Co-expressing G protein components to couple receptor activation to calcium signaling

  • Loading cells with a calcium-sensitive fluorescent dye

  • Screening potential ligands by measuring intracellular calcium responses upon compound application

In Vivo Behavioral Assays:
Correlating receptor function with behavioral responses requires:

  • Brief-access taste tests with potential Tas2r114 ligands

  • Two-bottle preference tests measuring aversion to bitter compounds

  • Comparison of wild-type mouse responses with those from genetic knockout models

Gene Expression Analysis:
For accurate quantification of the low-abundance Tas2r114:

  • Highly sensitive qRT-PCR with properly designed primers specific to Tas2r114

  • Digital droplet PCR for absolute quantification

  • RNAscope or similar highly sensitive in situ hybridization techniques for spatial expression patterns

These methodological approaches allow researchers to overcome the challenges associated with studying a less abundantly expressed receptor.

How can researchers differentiate between the functions of Tas2r114 and other Tas2r family members?

Differentiating between the functions of closely related Tas2r family members requires multiple complementary approaches:

Receptor-Specific Pharmacological Profiling:
Create a comprehensive activation profile by screening large libraries of bitter compounds (>100 compounds) against individually expressed Tas2r receptors. This approach has revealed that mouse bitter taste receptors exhibit diverse tuning properties, from narrowly to broadly responsive .

Comparison Table: Suggested Protocol for Differential Receptor Characterization

Experimental StepDetailsPurpose
Sequence alignment analysisCompare Tas2r114 with other mouse Tas2r receptorsIdentify unique structural features
Homology modelingBased on crystal structures of related GPCRsPredict binding pocket characteristics
Site-directed mutagenesisTarget predicted binding sitesDetermine key residues for ligand specificity
Chimeric receptor constructionExchange domains between Tas2r114 and other Tas2rsMap functional domains
Dose-response curvesTest identified ligands at multiple concentrationsDetermine EC50 values and efficacy
Antagonist screeningIdentify compounds that block specific Tas2rsDevelop tools for selective inhibition

Knockout/Knockin Approaches:
Generate mice with targeted mutations specifically in Tas2r114 while leaving other Tas2r genes intact. Compare behavioral and electrophysiological responses to bitter compounds between wild-type and mutant mice to determine Tas2r114-specific functions.

What are the reported ligands for Tas2r114 and how does its ligand profile compare with other mouse Tas2r receptors?

The search results indicate that comprehensive ligand profiling has been performed for mouse Tas2r receptors against a panel of 128 bitter substances . While specific ligands for Tas2r114 are not explicitly mentioned in the provided information, the general approach to characterizing bitter receptor ligand profiles is described.

For context, among the 35 putatively functional mouse Tas2r receptors, specific ligands have been previously reported for only two: Tas2r105 (activated by cycloheximide) and Tas2r108 (activated by denatonium benzoate and PROP, though with low potency) .

The comprehensive analysis mentioned in the search results likely included testing potential ligands for Tas2r114, but specific findings would require further research. Based on patterns observed in other species, receptors with lower expression levels like Tas2r114 might be more narrowly tuned (responding to fewer ligands) compared to abundantly expressed receptors.

Research Gap Analysis:
The limited characterization of mouse Tas2r ligand profiles, including Tas2r114, represents a significant research gap. This is particularly important when considering that:

  • The mouse is a primary model organism for taste research

  • Understanding receptor-ligand relationships is essential for functional studies

  • Species-specific Tas2r gene expansions may have resulted in specialized receptors for compounds relevant to each species' ecological niche

What expression systems are optimal for recombinant production of functional Tas2r114?

For successful recombinant production of functional Tas2r114, researchers should consider the following expression systems and modifications:

Mammalian Cell Expression:
HEK293T cells represent the gold standard for functional expression of bitter taste receptors. Key considerations include:

  • Codon optimization of the Tas2r114 sequence for improved expression

  • Addition of an N-terminal signal sequence (e.g., from rhodopsin) to enhance membrane trafficking

  • Introduction of epitope tags (e.g., FLAG, V5) for detection, while ensuring tags don't interfere with function

  • Co-expression with chaperone proteins to improve folding and trafficking

Alternative Expression Systems:

Expression SystemAdvantagesLimitationsRecommended Modifications
Sf9 insect cellsHigh protein yield, eukaryotic processingDifferent membrane compositionAdd N-terminal tags, optimize culture conditions
Yeast (S. cerevisiae)Eukaryotic processing, cost-effectiveDifferent sterol compositionUse inducible promoters, optimize codon usage
Cell-free systemsRapid production, membrane mimeticsLimited post-translational modificationsInclude nanodiscs or liposomes

Quality Control Metrics:
Success in recombinant Tas2r114 production should be assessed through:

  • Western blot analysis to confirm expression at expected molecular weight

  • Immunofluorescence to verify membrane localization

  • Functional calcium imaging assays to confirm ligand responsiveness

  • Binding assays with known ligands to verify protein folding

  • Size-exclusion chromatography to assess protein homogeneity

How can researchers effectively study the low expression levels of Tas2r114 in native tissues?

The search results indicate that Tas2r114 is expressed at very low levels in mouse taste tissues, "just reaching detection levels" . This presents significant challenges for researchers. Several specialized techniques can overcome these limitations:

Enhanced mRNA Detection Methods:

  • Digital Droplet PCR (ddPCR): This technique provides absolute quantification of low-abundance transcripts by partitioning the PCR reaction into thousands of nanoliter-sized droplets, allowing detection of single molecules.

  • NanoString Technology: Direct counting of mRNA molecules without amplification, reducing bias and improving accuracy for low-abundance transcripts.

  • Single-Cell RNA Sequencing: Identifying the specific subset of taste cells expressing Tas2r114, which might represent a rare population.

Protein Detection Strategies:

  • Proximity Ligation Assay (PLA): Enables detection of proteins with high sensitivity through antibody-based recognition followed by rolling circle amplification.

  • Highly Sensitive Custom Antibodies: Development of high-affinity antibodies specifically targeting unique epitopes of Tas2r114.

  • Mass Spectrometry with Targeted Selected Reaction Monitoring (SRM): Allows detection of specific peptides from Tas2r114 even in complex protein mixtures.

Functional Approaches for Low-Abundance Receptors:

  • Taste Cell Isolation and Single-Cell Calcium Imaging: Identifying responsive cells and correlating with molecular markers.

  • Genetic Labeling Approaches: Creating transgenic mice with fluorescent reporters driven by the Tas2r114 promoter to visualize expressing cells.

  • Overexpression Systems: Viral delivery of Tas2r114 to increase expression levels while maintaining native cellular context.

What are the most significant challenges in determining structure-function relationships for Tas2r114?

Determining structure-function relationships for Tas2r114 presents several unique challenges:

Technical Challenges:

  • Membrane Protein Crystallization: Like other GPCRs, Tas2r114 has seven transmembrane domains, making it difficult to crystallize for structural studies.

  • Low Natural Expression: The low abundance of Tas2r114 in native tissues complicates protein purification and functional studies.

  • Functional Redundancy: Potential overlap in ligand specificity with other Tas2r family members may obscure specific functions.

Methodological Approaches:

  • Computational Structure Prediction:

    • Homology modeling based on related GPCR structures

    • Molecular dynamics simulations to predict ligand binding pockets

    • Machine learning approaches incorporating limited experimental data

  • Functional Mapping Through Mutagenesis:

    • Alanine scanning of transmembrane domains

    • Creation of chimeric receptors between Tas2r114 and better-characterized Tas2rs

    • Point mutations guided by evolutionary conservation analysis

  • Advanced Structural Biology Techniques:

    • Cryo-electron microscopy for membrane proteins

    • Solid-state NMR spectroscopy

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

Research Strategy Table:

ChallengeSolution ApproachExpected Outcome
Limited structural informationImplement computational modeling based on class C GPCRsPredicted binding pocket structure
Low expression levelsUtilize nanobody stabilization for structural studiesEnhanced protein stability
Difficulties in functional assaysDevelop high-throughput screening against compound librariesIdentification of specific ligands
Receptor promiscuitySingle-point mutation analysis to identify key specificity residuesMap of structure-function relationships
Limited cross-species conservationComparative genomics across mouse strains with behavioral correlatesInsight into evolutionary adaptation

How does Tas2r114 compare with its orthologs in other species?

Understanding the evolutionary context of Tas2r114 requires comparative analysis with potential orthologs in other species. The search results don't provide specific information about Tas2r114 orthologs, but they do describe general patterns in taste receptor evolution that can inform our understanding:

Evolutionary Conservation and Divergence:

Bitter taste receptors (Tas2rs) show significant variation in gene number across vertebrate species. While mice have approximately 35 putatively functional Tas2r genes , other species have different numbers, ranging from complete absence in some aquatic mammals to varying numbers in other terrestrial vertebrates . This diversity reflects ecological adaptations to different chemical environments and feeding strategies.

The search results indicate that narrowly tuned Tas2rs are typically found only in species with larger Tas2r gene numbers, such as frogs and zebra finch, whereas species with fewer Tas2r genes (like chicken and turkey) tend to have broadly tuned receptors . This suggests that specialization of individual receptors occurs primarily in species with expanded bitter receptor repertoires.

Comparative Analysis Framework:

  • Sequence-Based Approaches:

    • Phylogenetic analysis to identify true orthologous relationships

    • Calculation of nonsynonymous to synonymous substitution ratios (dN/dS) to detect signatures of selection

    • Identification of conserved motifs that might be functionally critical

  • Functional Comparisons:

    • Cross-species pharmacological profiling of potential Tas2r114 orthologs

    • Correlation of receptor properties with species-specific feeding ecology

    • Heterologous expression of orthologs to compare ligand specificity

Given the low expression level of Tas2r114 in mice , it would be particularly interesting to determine whether its orthologs in other species show similar expression patterns, which might indicate conservation of a specialized function.

What insights can be gained from studying Tas2r114 polymorphisms across different mouse strains?

Studying Tas2r114 polymorphisms across different mouse strains can provide valuable insights into both receptor function and evolutionary adaptation:

Strain-Specific Variation:

While the search results don't specifically address Tas2r114 polymorphisms, they do mention that "naturally occurring polymorphisms contribute to individual variation in taste responses" in mice . This suggests that strain-specific variations in Tas2r114 might influence bitter taste perception in different mouse strains.

Research Approaches for Strain Comparison:

  • Genomic Analysis:

    • Sequencing Tas2r114 across diverse mouse strains (laboratory, wild, and wild-derived)

    • Identifying non-synonymous SNPs that might affect receptor function

    • Determining haplotype blocks and linkage relationships with other taste genes

  • Functional Characterization:

    • Expressing variant forms of Tas2r114 in heterologous systems

    • Measuring differences in dose-response relationships for identified ligands

    • Correlating receptor variations with behavioral differences in bitter compound acceptance

  • Ecological and Evolutionary Context:

    • Mapping strain origins geographically to identify potential environmental correlates

    • Analyzing dietary specializations of ancestral populations

    • Testing for signatures of selection on specific receptor variants

Significance of Strain Polymorphisms:

Understanding strain-specific variations in Tas2r114 could:

  • Reveal functional domains critical for ligand binding or receptor activation

  • Identify natural "experiments" in receptor evolution

  • Provide insight into adaption to different plant secondary compounds in diverse habitats

  • Explain strain-specific differences in feeding behavior and food selection

What considerations are important when designing knockout or transgenic models targeting Tas2r114?

Creating genetic models targeting Tas2r114 requires careful design to ensure specificity, effectiveness, and physiological relevance:

Strategic Design Considerations:

  • Targeting Specificity:

    • Tas2r genes often exist in clusters with high sequence similarity

    • CRISPR-Cas9 guide RNA design must avoid off-target effects on related Tas2r genes

    • Verification of specificity through comprehensive off-target analysis

  • Functional Validation Approaches:

    • qRT-PCR to confirm loss of Tas2r114 mRNA

    • Calcium imaging of taste cells to verify functional deficits

    • Behavioral assays to assess impact on bitter taste perception

Design Strategy Comparison:

Genetic ModificationAdvantagesLimitationsBest Application
Conventional knockoutComplete gene inactivationPotential developmental compensationUnderstanding basic receptor function
Conditional knockoutTemporal and spatial controlMore complex designDissecting adult vs. developmental roles
Knockin reporterVisualize expressing cellsMay affect native expressionCharacterizing expression patterns
Point mutationsStudy specific functional domainsSubtle phenotypesStructure-function analysis
OverexpressionAmplify low-level responsesNon-physiological expression levelsGain-of-function studies

Phenotypic Analysis Framework:

Given the relatively low expression of Tas2r114 , phenotypic analyses must be particularly sensitive:

  • High-resolution behavioral assays (e.g., lickometer analysis with millisecond precision)

  • Electrophysiological recordings from glossopharyngeal nerve

  • Calcium imaging from identified taste receptor cells

  • RNA-seq analysis of taste buds to detect compensatory changes

  • Metabolomic analysis of saliva and plasma to identify physiological consequences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.