Recombinant Mouse Taste receptor type 2 member 119 (Tas2r119)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Tas2r119; Tas2r19; Taste receptor type 2 member 119; T2R119; Taste receptor type 2 member 19; T2R19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tas2r119
Target Protein Sequence
MMEGHMLFFLLVVVVQFLTGVLANGLIVVVNAIDLIMWKKMAPLDLLLFCLATSRIILQL CILFAQLGLSCLVRHTLFADNVTFVYIINELSLWFATWLGVFYCAKIATIPHPLFLWLKM RISRLVPWLILASVVYVTVTTFIHSRETSELPKQIFISFFSKNTTRVRPAHATLLSVFVF GLTLPFLIFTVAVLLLLSSLWNHSRQMRTMVGTREPSRHALVSAMLSILSFLILYLSHDM VAVLICTQGLHFGSRTFAFCLLVIGMYPSLHSIVLILGNPKLKRNAKTFIVHCKCCHCAR AWVTSRNPRLSDLPVPATHHSANKTSCSEACIMPS
Uniprot No.

Target Background

Function

Gustducin-coupled receptor involved in the detection of bitter compounds within the oral cavity and gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.

Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in 15% taste bud cells in circumvallate and foliate papillae but only in 2% in fungiform papillae. Expressed in the gas

Q&A

What is the expression pattern of Tas2r119 in mouse gustatory tissues? (Basic)

Tas2r119 belongs to the family of mouse taste receptors that are expressed in the epithelium of the posterior tongue. While specific data for Tas2r119 expression levels aren't directly provided in the search results, research has demonstrated that all mouse Tas2r genes are expressed in gustatory tissue, confirming their role in bitter taste perception . Expression levels vary significantly among different Tas2r receptors, with some being highly abundant (reaching ~20% of α-gustducin mRNA levels) while others are barely detectable .

Methodologically, researchers can quantify Tas2r119 expression using quantitative RT-PCR (qRT-PCR) and visualize its cellular expression pattern through in situ hybridization experiments on sections of vallate papillae. These techniques allow for comparison of expression levels between different taste receptors and identification of the specific subset of taste cells expressing Tas2r119 .

How does Tas2r119 expression compare with other Tas2r family members in non-gustatory tissues? (Advanced)

While our search results don't provide specific data for Tas2r119 expression in non-gustatory tissues, studies have shown that Tas2r expression patterns differ significantly between gustatory and non-gustatory tissues. For example, Tas2r genes with low expression in lingual papillae (like Tas2r114) can exhibit robust expression in tissues such as testis .

To investigate this comprehensively for Tas2r119, researchers should:

  • Design tissue-specific primers for Tas2r119

  • Collect RNA from multiple tissue types (gustatory and non-gustatory)

  • Perform comparative qRT-PCR analysis

  • Normalize expression against housekeeping genes

  • Validate with in situ hybridization to confirm cellular localization

This comparative approach is critical as it reveals tissue-specific regulation of Tas2r genes, which may provide insights into non-gustatory functions of taste receptors .

What are the key considerations for designing heterologous expression systems for mouse Tas2r119? (Basic)

When designing heterologous expression systems for mouse Tas2r119, researchers must consider several critical factors:

  • Cell line selection: HEK293T cells are commonly used for taste receptor expression due to their high transfection efficiency and low endogenous expression of taste signaling components .

  • G-protein coupling: The choice of G-protein significantly impacts assay sensitivity. For Tas2r experiments, Gα16gust44 appears to provide higher sensitivity than Gα15, as demonstrated with Tas2r105 . Researchers should consider using Gα16gust44 for Tas2r119 studies to enhance detection of low-efficacy activators.

  • Receptor tagging: Adding epitope tags (like Rho) to the N-terminus of the recombinant Tas2r can facilitate detection and localization studies without significantly affecting function .

  • Expression verification: Confirm proper expression and membrane localization through immunofluorescence or Western blotting before functional assays.

  • Calcium imaging optimization: Since taste receptors are typically coupled to calcium signaling pathways, optimize calcium indicator dye loading conditions and imaging parameters.

This systematic approach ensures reliable functional characterization of Tas2r119 in heterologous systems .

How should researchers design experiments to identify specific agonists for Tas2r119? (Advanced)

Designing robust experiments to identify specific agonists for Tas2r119 requires a systematic approach with appropriate controls:

  • Compound library selection: Curate a diverse library of potential bitter compounds (100+ substances) based on structural diversity and known bitter taste properties. Include compounds that activate other Tas2r receptors to test for specificity .

  • Experimental design considerations:

    • Define clear independent variables (compound identity, concentration ranges)

    • Select appropriate dependent variables (calcium flux, receptor internalization)

    • Control for extraneous variables (cell passage number, transfection efficiency)

    • Include proper positive controls (known bitter compounds) and negative controls (vehicle)

  • Dose-response analysis: Test all compounds at multiple concentrations (typically 3μM to 1mM) to generate complete dose-response curves, calculating EC50 values and efficacy parameters .

  • Cross-validation approach: Confirm hits using orthogonal assays such as:

    • GTPγS binding assays

    • β-arrestin recruitment

    • Receptor internalization

  • Specificity determination: Test identified agonists against other Tas2r family members to identify compounds that are uniquely recognized by Tas2r119 .

The critical methodological insight here is employing a G-protein system with appropriate sensitivity, as demonstrated by the fact that low-efficacy activators of Tas2r receptors may show responses in Gα16gust44-expressing cells but not in Gα15-based assays .

What functional assays are most appropriate for characterizing Tas2r119 activation? (Basic)

For characterizing Tas2r119 activation, several functional assays can be employed, with calcium mobilization assays being the most widely used:

  • Calcium imaging assays: The primary approach involves transfecting cells with Tas2r119 alongside a suitable G-protein (preferably Gα16gust44), loading with a calcium-sensitive dye (Fluo-4 AM), and measuring fluorescence changes upon compound addition. This method allows for real-time monitoring of receptor activation .

  • FLIPR-based high-throughput screening: For testing numerous compounds, Fluorescent Imaging Plate Reader (FLIPR) technology enables simultaneous measurement of calcium responses across entire 96- or 384-well plates.

  • Electrophysiological recordings: In more specialized settings, electrophysiological techniques can measure channel activity downstream of Tas2r119 activation, providing high temporal resolution.

When planning these assays, researchers should consider:

  • Including positive controls (compounds known to activate similar Tas2r receptors)

  • Using appropriate negative controls (untransfected cells, cells expressing other Tas2rs)

  • Testing compounds across multiple concentrations to generate dose-response curves

  • Calculating threshold concentrations and EC50 values for detected agonists

How can researchers differentiate between the activation profiles of Tas2r119 and closely related Tas2r receptors? (Advanced)

Differentiating activation profiles between Tas2r119 and related receptors requires sophisticated methodological approaches:

  • Comparative pharmacological profiling: Test a diverse panel of bitter compounds on cells expressing individual Tas2r receptors under identical conditions. Create comprehensive activation matrices showing:

CompoundTas2r119 EC50 (μM)Tas2r119 Efficacy (%)Related Tas2r EC50 (μM)Related Tas2r Efficacy (%)
Compound AXYX'Y'
Compound BXYX'Y'
Etc.............
  • Receptor chimera approach: Create chimeric receptors by swapping domains between Tas2r119 and related receptors to identify structural determinants of ligand specificity.

  • Site-directed mutagenesis: Identify putative ligand-binding residues in Tas2r119 through structural modeling and systematically mutate them to assess their contribution to agonist recognition.

  • Antagonist profiling: Develop and test putative antagonists that may selectively block Tas2r119 but not related receptors.

  • Signaling bias analysis: Compare different downstream signaling pathways (calcium mobilization, ERK phosphorylation, receptor internalization) to identify potential biased signaling between receptors.

The research by Lossow et al. demonstrated that despite partially overlapping agonist profiles, each mouse Tas2r is activated by a unique subset of compounds, with some receptors having specific cognate agonists not detected by any other Tas2r . This methodological approach can be applied specifically to Tas2r119 characterization.

How should researchers interpret variations in Tas2r119 expression levels observed across different mouse strains? (Basic)

When interpreting variations in Tas2r119 expression levels across different mouse strains, researchers should consider:

  • Methodological consistency: Ensure that tissue collection, RNA extraction, and qRT-PCR protocols are standardized across all samples. Normalize expression data against stable reference genes (e.g., GAPDH, β-actin).

  • Physiological relevance: Correlate expression differences with behavioral responses to bitter compounds in brief-access taste tests. Significant expression variations may explain strain-specific taste preferences or aversions .

  • Genetic background effects: Analyze whether differences correlate with known genetic polymorphisms in Tas2r119 or its regulatory regions. This may involve sequencing the Tas2r119 gene and promoter regions from different strains.

  • Developmental considerations: Assess whether expression differences are consistent across different developmental stages or emerge at specific points during development.

  • Environmental influences: Consider whether housing conditions, diet, or other environmental factors might contribute to observed variations.

The comprehensive analysis by Lossow et al. showed that even within a single strain, Tas2r genes exhibit different expression patterns, with some being abundantly expressed while others barely reach detection levels . This methodological approach of normalizing expression against α-gustducin provides a useful benchmark for comparing expression levels across different receptors and potentially across different strains.

What are the potential causes and solutions for discrepancies in Tas2r119 functional data between in vitro and in vivo studies? (Advanced)

Discrepancies between in vitro and in vivo functional data for Tas2r119 can stem from multiple sources:

  • Signaling component differences: Heterologous systems may lack specific signaling components present in native taste cells. Solution: Supplement expression systems with additional taste signaling molecules (e.g., PLCβ2, TRPM5) or use taste cell-derived cell lines .

  • Post-translational modifications: Native Tas2r119 may undergo specific modifications absent in heterologous systems. Solution: Analyze receptor glycosylation, phosphorylation states, and compare protein mobility on Western blots between native and recombinant systems.

  • Receptor trafficking differences: Heterologous systems may not properly traffic Tas2r119 to the cell surface. Solution: Verify proper localization using microscopy with non-permeabilized cells to confirm surface expression, similar to the analysis showing "clear external localization of Rho epitopes added to the N terminus of recombinant Tas2r" .

  • Assay sensitivity limitations: As demonstrated with Tas2r105, different G-protein coupling systems show varying sensitivity. Solution: Compare results using multiple G-protein systems (Gα15 vs. Gα16gust44) .

  • Compound bioavailability and metabolism: In vivo, compounds may be metabolized or fail to reach taste cells at effective concentrations. Solution: Perform pharmacokinetic studies to determine compound stability and concentration at the site of action.

A systematic approach to resolving these discrepancies involves:

  • Developing more physiologically relevant in vitro systems (e.g., primary taste cell cultures)

  • Designing parallel in vitro and in vivo experiments with identical compounds and concentration ranges

  • Correlating cellular responses with behavioral outcomes using genetic knockout models

  • Considering the heterogeneity of taste receptor-expressing cells shown through in situ hybridization experiments

How do functional properties of mouse Tas2r119 compare to orthologous receptors in other species? (Basic)

When comparing mouse Tas2r119 to orthologous receptors in other species, researchers should consider:

  • Sequence homology analysis: Conduct alignment of Tas2r119 protein sequences across species to identify conserved and divergent regions, particularly in predicted ligand-binding domains.

  • Functional conservation assessment: Compare agonist profiles across species using standardized heterologous expression assays. Lossow et al. noted that some species with few Tas2r genes (like chicken and turkey) have broadly tuned receptors, suggesting different evolutionary strategies for bitter taste perception .

  • Expression pattern comparison: Determine whether orthologous receptors share similar tissue expression patterns using comparative qRT-PCR and in situ hybridization studies.

  • Behavioral correlation: Compare behavioral responses to common Tas2r119 agonists across species through standardized taste preference or aversion tests.

While specific data for Tas2r119 orthologs weren't provided in the search results, the methodological approach used by Lossow et al. revealed functional differences between mouse and human bitter taste receptor orthologs that required "adjustment of firm beliefs in light of these data" . This highlights the importance of experimental verification rather than assuming functional conservation based solely on sequence similarity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.