Recombinant Mouse Taste receptor type 2 member 125 (Tas2r125)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Research Findings

Tas2r125 is primarily implicated in bitter taste detection, with specialized responsiveness to specific compounds. Key findings include:

Bitter Taste Recognition

  • Primary Ligands: Tas2r125 is the main receptor for detecting the bitterness of tea catechins, particularly (-)-epicatechin gallate (ECg) and (-)-epigallocatechin gallate (EGCg) .

  • Behavioral Relevance: Mice exhibit strong avoidance behavior toward ECg, aligning with Tas2r125’s activation profile .

  • Tissue-Specific Expression: Tas2r125 mRNA is predominantly expressed in circumvallate papillae (taste buds on the tongue), with minimal expression in other tissues .

Comparative Analysis with Other Tas2r Receptors

Mouse bitter taste receptors vary in tuning breadth:

ReceptorTuning ProfileKey AgonistsPotency Range
Tas2r105Broadly tuned (generalist)Cycloheximide, N-acyl homoserine lactonesEC₅₀: 0.3–1.0 μm
Tas2r125Narrowly tuned (specialist)ECg, EGCgEC₅₀: Not explicitly reported
Tas2r144Moderately tunedMultiple bitter compoundsEC₅₀: Varies by agonist

Tas2r125’s restricted agonist profile contrasts with broadly tuned receptors like Tas2r105, suggesting a specialized role in detecting specific bitter compounds .

Product Variants

Catalog NumberHostTagLengthApplication
RFL34958MF E. coliHisFull-length (1–311)Cell-based assays, ligand binding studies
TAS2R125-9010M HEK293His/Fc/AviFull-lengthSurface plasmon resonance, ELISA
CSB-CF755512MO E. coliHisFull-lengthReceptor-ligand interaction studies

Key Technical Parameters

ParameterDetails
Purification MethodNickel affinity chromatography (His-tag)
BufferTris/PBS with 6% trehalose, pH 8.0
StabilityAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for 1 week

Bitter Taste Mechanisms

  • Ligand Screening: Tas2r125 is used to identify bitter compounds in food and pharmaceuticals, such as catechins in tea .

  • Species-Specific Bitter Perception: Unlike human TAS2R38 (sensitive to PROP), Tas2r125 does not respond to β-d-glucopyranosides, highlighting species-specific bitter perception .

Physiological and Pharmacological Studies

  • Gastrointestinal Defense: While Tas2r125 is not expressed in the gut, other Tas2r (e.g., Tas2r108) may mediate gut responses to bitter compounds .

  • Drug Development: Recombinant Tas2r125 aids in screening bitter-tasting pharmaceuticals to improve palatability.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate any special format requirements. Please specify your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own protocols.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form offers a longer shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the protein with your specified tag.
Synonyms
Tas2r125; T2r59; Taste receptor type 2 member 125; T2R125; mT2R59
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tas2r125
Target Protein Sequence
MMGIAIDILWAAIIIVQFIIGNIANGFIALVNIIDWVKRRKISLMDKIITALAISRIYLL WSTFLITLTSSLDPDIKMAVKIIRISNNTWIIANHFSIWFATCLSIFYFLKIANFSNYIF LYLRWRFKKVVSVTLLISLIFLLLNILLMNMHIDIWSDKSKRNLSFSVRSNNCTQFPRLV LLINTMFTSIPFTVSLLAFLLLIFSLWRHLKTMQYYAKGSEDTTTAAHIKALHMVVAFLL FYTVFFLSLAIQYWTSGSQENNNLFYATIVITFPSVHSCILILRNSQLRQASLLVLWWLL CKSKDVRMLVP
Uniprot No.

Target Background

Function
This protein is a putative taste receptor that may play a role in the perception of bitterness.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Mouse Tas2r125 and how does it relate to other taste receptors?

Mouse Tas2r125 is one of approximately 35 putatively functional bitter taste receptors (Tas2rs) in mice. These G protein-coupled receptors mediate bitter taste perception by detecting potentially harmful substances. Mouse Tas2rs, like their human counterparts (TAS2Rs), exhibit varying degrees of tuning breadth, from narrowly tuned "specialists" to broadly tuned "generalists" . The mouse Tas2r gene family is distributed across multiple chromosomes, with certain Tas2r genes exhibiting one-to-one orthology with human bitter receptors, suggesting evolutionary conservation of function .

How is Tas2r125 expression typically analyzed in mouse tissue?

Expression analysis of Tas2r125, like other Tas2r genes, can be performed using quantitative RT-PCR (qRT-PCR) with specific primer pairs and TaqMan fluorescent probes . For accurate analysis, researchers should:

  • Design gene-specific primers that avoid cross-reactivity with other Tas2r family members

  • Use appropriate housekeeping genes (e.g., β-actin) as internal controls

  • Run samples in triplicate with proper negative controls (no reverse transcriptase and water controls)

  • Analyze threshold cycle (CT) values using comparative CT (ΔΔCT) method

In situ hybridization can complement qRT-PCR by providing spatial information about Tas2r125 expression at the cellular level, as demonstrated for other Tas2r family members .

What is the typical expression pattern of Tas2r genes in mouse taste tissues?

Tas2r genes show variable expression patterns in mouse taste tissues. qRT-PCR analysis of the posterior tongue epithelium reveals that some Tas2r receptors (like Tas2r108, Tas2r118, Tas2r126, Tas2r135, and Tas2r137) are highly abundant, reaching approximately 20% of α-gustducin mRNA levels, while others (like Tas2r114, Tas2r122, and Tas2r140) are expressed at much lower levels . In situ hybridization studies confirm this heterogeneity, showing different numbers of expressing cells and variable staining intensities for different Tas2r mRNAs in vallate papillae .

What expression systems are recommended for recombinant production of mouse Tas2r125?

For functional characterization of mouse Tas2r125, heterologous expression in human embryonic kidney (HEK293T) cells is commonly used, similar to protocols established for other Tas2r receptors. These cells should be engineered to stably express either:

  • Gα15 (less sensitive system) or

  • Gα16gust44 (chimeric G protein with enhanced sensitivity)

The choice of G protein can significantly impact assay sensitivity, as demonstrated with Tas2r105, where low-efficacy activators showed reduced or absent responses in Gα15-expressing cells compared to Gα16gust44-expressing cells .

What are the critical considerations for optimizing Tas2r125 cell surface expression?

Ensuring adequate cell surface expression is crucial for successful functional characterization of recombinant Tas2r125. Consider these approaches:

  • Add N-terminal epitope tags (e.g., Rho tag) to monitor expression via immunocytochemistry

  • Assess surface expression in both permeabilized and non-permeabilized cells to distinguish between total protein and correctly trafficked receptor

  • Consider cell-surface expression assays before functional testing, as some Tas2r receptors (e.g., Tas2r102 and Tas2r131) show insufficient surface localization, which may prevent successful deorphanization

Table 1: Cell Surface Expression Patterns of Selected Mouse Tas2r Receptors

ReceptorBefore permeabilizationAfter permeabilizationFunctional activity detected
Tas2r102-+No
Tas2r105++Yes
Tas2r106++No
Tas2r108++Yes
Tas2r131-+No
Tas2r134++No
Mock--No

Note: This table is adapted from mouse Tas2r expression data and serves as a reference for expected expression patterns.

What are the established methods for functional deorphanization of recombinant Tas2r125?

Functional characterization of recombinant Tas2r125 typically employs calcium imaging techniques in heterologous expression systems. Key methodological considerations include:

  • Transfect HEK293T cells with the Tas2r125 expression construct and appropriate G protein (preferably Gα16gust44)

  • Load cells with calcium-sensitive fluorescent dyes (e.g., Fluo-4 AM)

  • Create a comprehensive bitter compound library for screening, ideally containing 100+ diverse bitter substances

  • Measure changes in intracellular calcium levels (ΔF/F) in response to test compounds

  • Determine receptor activation thresholds, efficacy (maximal signal amplitude), and potency (EC50 values)

  • Include known bitter compound controls and validate hits with dose-response analyses

How should agonist screening for Tas2r125 be designed to maximize success?

When screening for Tas2r125 agonists, consider these research-based strategies:

  • Use a diverse compound library that includes:

    • Plant-derived bitter compounds (alkaloids, polyphenols, etc.)

    • Synthetic bitter substances

    • Structurally related series of compounds

    • Bitter compounds with known activity at other Tas2r receptors

  • Start with a broad screening approach at higher concentrations (~1 mM where solubility permits) before performing dose-response analyses

  • Account for differences in efficacy and potency:

    • Some agonists may activate receptors with high efficacy (large signal amplitude) but low potency (high EC50)

    • Others may show high potency (low EC50) but low efficacy (small signal amplitude)

  • For potential Tas2r125-specific compounds, test activation against multiple Tas2r receptors to assess selectivity profiles

How can I validate that my recombinant Tas2r125 construct is functional?

Validating a recombinant Tas2r125 construct involves multiple complementary approaches:

  • Sequence verification to confirm proper cloning and absence of mutations

  • Expression validation:

    • Western blot analysis of whole-cell lysates

    • Immunocytochemistry with and without permeabilization to assess cell surface expression

  • Functional validation:

    • Test against a panel of known broad bitter agonists that activate multiple Tas2r receptors

    • Include positive controls (receptors with known agonists) in parallel experiments

    • Consider using chimeric constructs with well-characterized Tas2r domains if initial testing fails

What controls are essential for Tas2r125 expression and functional studies?

Rigorous control experiments are critical for reliable Tas2r125 research:

For expression studies:

  • No-template controls and no-reverse transcriptase controls in qRT-PCR

  • Sense probe controls in in situ hybridization experiments

  • Mock-transfected cells in immunocytochemistry experiments

For functional assays:

  • Vehicle controls (solvent only)

  • Mock-transfected cells expressing the same G protein

  • Positive control receptors with known agonists

  • Internal standards for normalization between experiments

How can structure-function relationships of Tas2r125 be investigated?

Investigating structure-function relationships of Tas2r125 involves several advanced approaches:

  • Site-directed mutagenesis of key residues:

    • Target conserved motifs across Tas2r family members

    • Focus on predicted transmembrane domains and extracellular loops

    • Create systematic alanine-scanning libraries

  • Chimeric receptor approach:

    • Swap domains between Tas2r125 and functionally characterized Tas2r receptors

    • Identify regions critical for agonist recognition or G protein coupling

  • Homology modeling based on:

    • Crystal structures of other GPCRs

    • Molecular dynamics simulations to predict ligand binding pockets

Structure-function analyses of human TAS2Rs have revealed that minor amino acid sequence differences can significantly impact agonist profiles, and even receptors with substantial sequence divergence may recognize overlapping compounds through different binding modes .

What approaches can address challenges in deorphanizing Tas2r125 if initial screens fail?

If initial deorphanization efforts for Tas2r125 are unsuccessful, consider these advanced troubleshooting strategies:

  • Expand compound screening:

    • Test additional compound libraries, particularly naturally occurring bitter substances

    • Examine species-specific bitter compounds relevant to mouse dietary ecology

  • Optimize expression system:

    • Test alternative signal transduction components (different G proteins)

    • Try different expression vectors or cell types

    • Consider adding chaperones to enhance proper folding and trafficking

  • Bioinformatic approaches:

    • Analyze sequence similarity with functionally characterized Tas2r receptors

    • Identify potential one-to-one orthologs in human or other species

    • Predict candidate ligands based on pharmacophore models from related receptors

Studies show that 13 of 35 mouse Tas2r receptors initially resisted deorphanization despite testing with 128 bitter compounds, suggesting that specialized or currently unknown ligands may exist for these receptors .

Does Tas2r125 expression extend beyond gustatory tissues?

While the search results don't specifically address Tas2r125 extraoral expression, research on other Tas2r family members suggests Tas2r receptors may serve functions beyond taste perception. For example:

  • Some mouse Tas2r genes show differential expression patterns between gustatory and non-gustatory tissues:

    • Tas2r113 and Tas2r124 show high expression in testis despite moderate to low expression in taste tissues

    • Tas2r114, with low expression in lingual papillae, exhibits robust expression in testis

  • Tas2r131 has been detected in mucin-producing goblet cells in the mouse colon

These findings suggest that Tas2r125 may potentially be expressed in non-gustatory tissues, where it could serve physiological functions distinct from bitter taste perception.

How might recombinant Tas2r125 research contribute to understanding bitter taste perception?

Research on recombinant Tas2r125 can advance our understanding of bitter taste perception in several ways:

  • Completing the functional map of mouse bitter taste receptors:

    • Only 21 of 35 putatively functional mouse Tas2r have identified agonists

    • Characterizing Tas2r125 would contribute to a more comprehensive understanding of mouse bitter taste reception

  • Comparative receptor tuning analysis:

    • Determining whether Tas2r125 functions as a "specialist" (narrow tuning) or "generalist" (broad tuning)

    • Understanding its agonist profile relative to other mouse Tas2r and human TAS2R orthologs

  • Evolutionary perspectives:

    • Investigating whether Tas2r125 responds to species-specific bitter compounds relevant to mouse dietary ecology

    • Comparing functional properties with human counterparts to understand evolutionary divergence or conservation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.