Recombinant Mouse Taste receptor type 2 member 13 (Tas2r13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tas2r13; Tas2r121; Taste receptor type 2 member 13; T2R13; Taste receptor type 2 member 121; T2R121; mT2R48
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGSNVYGILTMVMIAEFVFGNMSNGFIVLINCIDWVRKGTLSSIGWILLFLAISRMVLIW EMLITWIKYMKYSFSFVTGTELRGIMFTWVISNHFSLWLATILSIFYLLKIASFSKPVFL YLKWREKKVLLIVLLGNLIFLMLNILQINKHIEHWMYQYERNITWSSRVSDFAGFSNLVL LEMIVFSVTPFTVALVSFILLIFSLWKHLQKMHLNSRGERDPSTKAHVNALRIMVSFLLL YATYFISFFLSLIPMAHKTRLGLMFSITVGLFYPSSHSFILILGHSNLRQASLWVMTYLK CGQKH
Uniprot No.

Target Background

Function
This receptor may play a crucial role in perceiving bitterness and is linked to gustducin. It may also contribute to sensing the chemical composition of the gastrointestinal content. Activation of this receptor could stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and structure of mouse Tas2r13?

Mouse Tas2r13 is located on chromosome 12 and belongs to the Tas2r (taste receptor type 2) gene family that encodes G protein-coupled receptors involved in bitter taste detection. The gene contains coding sequences for a bitter taste receptor that functions within the gustatory system. Structurally, Tas2r13 shares the typical characteristics of bitter taste receptors, which include seven transmembrane domains and specific binding regions for bitter compounds .

How does Tas2r13 function in the bitter taste perception pathway?

Tas2r13 functions as a chemosensory receptor that detects bitter compounds. When a bitter ligand binds to Tas2r13, it initiates a signal transduction cascade that typically involves G protein activation (particularly α-gustducin), leading to intracellular calcium release and eventual signal transmission to the brain. This pathway is part of the broader taste perception mechanism that allows mice to discriminate potentially harmful bitter substances in their environment .

What genetic polymorphisms in Tas2r13 have been identified and what are their functional implications?

A significant single nucleotide polymorphism (SNP) within the Tas2r13 gene, rs1015443 (C1040T, Ser259Asn), has been identified and shows association with differences in alcohol consumption behaviors. Research indicates that subjects homozygous for the major allele (CC carriers) consumed alcoholic beverages less frequently compared to heterozygotes and those homozygous for the minor allele. This suggests that genetic variation in this receptor may influence taste perception of alcohol or related compounds, thereby affecting consumption patterns .

How do variations in Tas2r13 correlate with behavioral phenotypes?

Variations in Tas2r13, particularly the rs1015443 SNP, have been significantly associated with measures of alcohol consumption as assessed using the Alcohol Use Disorders Identification Test (AUDIT). Specifically, this variation correlates with measures designated as "PERDAY" (p = 0.0011) and "SIXORMORE" (p = 0.000231), which assess frequency and quantity of alcohol consumption. These associations remained significant even after correction for multiple comparisons (Bonferroni values of 0.03 and 0.005, respectively), indicating a robust relationship between Tas2r13 genetic variation and alcohol consumption behaviors .

What is the linkage disequilibrium (LD) pattern around Tas2r13?

Analysis of the genomic region surrounding Tas2r13 has revealed a complex LD structure. Several LD blocks have been identified in proximity to Tas2r13, including a block containing four SNPs (rs619381, rs1548803, rs10845219, and rs4763216) located approximately 79kb upstream of rs1015443, extending for about 28kb. The Tas2r13 SNP rs1015443 displays moderate LD with SNPs in this block (r² = 0.13–0.65). Additionally, detailed LD analysis including SNPs in nearby genes (PRH1 and PRR4) showed that SNP rs10492098 was in tight LD with rs1015443 (r² = 0.96) .

How is Tas2r13 expression regulated in gustatory tissues?

While the provided research doesn't specifically detail Tas2r13 regulation, studies on mouse Tas2r genes in general demonstrate that expression levels vary considerably among different receptors. Quantitative RT-PCR and in situ hybridization experiments show that all mouse Tas2r genes are expressed in the epithelium of the posterior tongue, particularly in taste cells of the vallate papillae. Expression patterns range from abundant (reaching ~20% of α-gustducin mRNA levels for some receptors) to barely detectable. These variations in expression may reflect the differential importance of detecting specific bitter compounds in the mouse diet .

What methods are recommended for detecting Tas2r13 expression in tissue samples?

For detecting Tas2r13 expression in tissue samples, researchers typically employ:

  • Quantitative RT-PCR (qRT-PCR): This technique allows quantification of Tas2r13 mRNA levels relative to reference genes such as α-gustducin.

  • In situ hybridization: This method visualizes Tas2r13 mRNA in tissue sections, enabling identification of specific cell populations expressing the receptor.

  • Immunocytochemistry/immunohistochemistry: Using antibodies against Tas2r13 or epitope tags for recombinant versions can visualize protein expression and cellular localization.

When performing these analyses, it's important to include appropriate controls and reference genes to ensure accurate interpretation of expression patterns .

What heterologous expression systems are most effective for functional characterization of recombinant Tas2r13?

For functional characterization of recombinant Tas2r13, researchers typically use heterologous expression systems such as human embryonic kidney (HEK)-293T cells or similar cell lines. The following methodology is recommended:

  • Generate expression constructs containing the Tas2r13 coding sequence, ideally with an N-terminal epitope tag (such as Rho tag) to facilitate detection.

  • Transiently transfect cells with the Tas2r13 construct along with a chimeric G protein to couple the receptor to calcium signaling pathways.

  • Assess receptor function using calcium imaging assays, where cells are loaded with calcium-sensitive fluorescent dyes and receptor activation is measured as changes in intracellular calcium levels upon exposure to potential agonists.

  • Verify cell surface expression through immunocytochemistry on both permeabilized and non-permeabilized cells to distinguish between total expression and functional cell surface localization .

How can researchers identify and validate specific agonists and antagonists for Tas2r13?

To identify and validate specific agonists and antagonists for Tas2r13:

  • Perform systematic screening using a diverse library of bitter compounds at various concentrations in heterologous expression systems.

  • Generate dose-response curves for identified agonists to determine EC50 values and efficacy parameters.

  • Validate agonist specificity by testing the same compounds on other Tas2r family members to determine the receptor's selectivity profile.

  • Conduct structure-activity relationship studies with related compounds to identify critical molecular features for receptor activation.

  • For in vivo validation, conduct behavioral tests such as brief-access taste tests or two-bottle preference tests with wild-type mice versus Tas2r13 knockout models.

  • Use calcium imaging in taste cells from transgenic mice expressing fluorescent markers in Tas2r13-positive cells to confirm native receptor activation by identified agonists .

What are the current challenges in generating functional Tas2r13 knockout models?

Generating functional Tas2r13 knockout models presents several challenges:

  • Potential functional redundancy among Tas2r family members, as many bitter compounds activate multiple receptors, which may mask phenotypes in single receptor knockouts.

  • Complex linkage disequilibrium patterns around Tas2r13 may complicate interpretation of genetic models if nearby genes are affected.

  • Verification of complete functional elimination requires careful analysis of expression at both mRNA and protein levels in taste tissues.

  • Phenotypic characterization requires sensitive behavioral assays that can detect subtle changes in bitter taste perception or preferences.

  • Generation of taste receptor-specific conditional knockouts may be necessary to avoid developmental compensation that could obscure adult phenotypes.

When developing knockout models, researchers should consider employing CRISPR-Cas9 technology for precise gene editing and implement comprehensive validation approaches to ensure complete functional elimination of the target receptor .

How does mouse Tas2r13 compare to its human orthologs in terms of sequence and function?

  • Some Tas2r genes exhibit one-to-one orthology between humans and mice, particularly those located on human chromosomes 5 and 7 and mouse chromosomes 2 and 15, suggesting they developed prior to the divergence of primate and rodent lineages.

  • Structure-function analyses of human bitter taste receptors reveal that very few differences in amino acid sequences can account for largely deviating agonist spectra.

  • Human TAS2R paralogs with pronounced amino acid sequence differences can have agonists in common even though they recognize these compounds through different binding modes.

Researchers interested in comparative studies should perform detailed sequence analyses and functional characterization of both mouse Tas2r13 and potential human orthologs to establish true functional relationships .

What are the implications of Tas2r13 genetic variations for alcohol-related behaviors and disorders?

Research on Tas2r13 has revealed significant implications for alcohol-related behaviors:

  • The rs1015443 SNP in Tas2r13 shows robust association with measures of alcohol consumption in head and neck cancer patients, who typically have relatively high premorbid levels of alcohol intake.

  • Subjects homozygous for the major allele (CC carriers) consumed alcoholic beverages less frequently compared to heterozygotes and those homozygous for the minor allele, suggesting a protective effect.

  • This association remained significant even after statistical correction for multiple comparisons, indicating a genuine biological relationship.

  • Analysis with other SNPs in proximity to rs1015443 suggests that this Tas2r13 locus is principally responsible for the observed association with alcohol consumption.

These findings suggest that genetic screening for Tas2r13 variations might help identify individuals with predisposition to increased alcohol consumption, potentially enabling earlier interventions for at-risk populations .

How can data from Tas2r13 research be integrated with broader taste perception studies?

To integrate Tas2r13 research with broader taste perception studies:

  • Conduct comprehensive profiling of bitter compound recognition across the entire Tas2r family to identify overlapping and distinct agonist profiles, placing Tas2r13 in the context of the complete bitter taste receptor repertoire.

  • Perform co-expression analyses to determine which Tas2r receptors are expressed in the same taste cells, potentially indicating functional cooperation.

  • Combine genetic association studies of multiple Tas2r variants with psychophysical taste tests to understand how genetic variations across multiple receptors collectively influence bitter taste perception.

  • Investigate potential cross-modal interactions between bitter taste receptors and receptors for other taste modalities (sweet, umami, sour, salty) to understand how Tas2r13 functions within the integrated taste perception system.

  • Explore the expression and function of Tas2r13 in extra-oral tissues, as bitter taste receptors have been found in various organs including the respiratory, gastrointestinal, and genitourinary systems, suggesting broader physiological roles beyond taste perception .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.