Recombinant Mouse Taste receptor type 2 member 39 (Tas2r39)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

Tas2r39 is encoded by the Tas2r39 gene, which is intronless and located in the mouse genome. The encoded protein is a 338-amino-acid G-protein-coupled receptor (GPCR) with seven transmembrane domains (TM1–TM7) and extracellular and intracellular loops (Fig. 1). Key structural features include:

  • Transmembrane Helices: Critical for ligand binding and signal transduction.

  • Extracellular Loops (ECLs): Involved in agonist recognition.

  • Intracellular Loops (ICLs): Interact with G-proteins like α-gustducin to mediate signaling .

FeatureDescription
GeneTas2r39 (intronless)
Protein Length338 amino acids
Transmembrane DomainsTM1–TM7
Key MotifsHydrophobic binding pocket between TMs III, V, VI, VII

Production and Purity

Recombinant Tas2r39 is synthesized using heterologous expression systems to study its function in vitro. Common production methods include:

Host SystemPurityApplications
Cell-Free Expression≥85% (SDS-PAGE)High-throughput ligand screening
E. coli/Yeast≥85% (SDS-PAGE)Structural studies (e.g., X-ray crystallography)
Mammalian Cells≥85% (SDS-PAGE)Functional assays (e.g., calcium mobilization)

Partial recombinant variants (e.g., truncated or tagged proteins) are also available for targeted studies .

Functional Characteristics

While human TAS2R39 is well-studied for detecting isoflavones, theaflavins, and dipeptides, the mouse ortholog exhibits distinct functional properties:

Expression and Tissue Localization

  • Gustatory Tissue: Expressed in posterior tongue papillae (vallate and foliate) alongside other Tas2r members .

  • Extraoral Tissues: Limited data, but human studies suggest potential roles in the colon, bronchi, and arteries .

Ligand Specificity

Mouse Tas2r39 has not been extensively deorphanized. In contrast to human TAS2R39, which binds broad ligand classes (e.g., flavonoids, dipeptides), the mouse receptor shows restricted agonist profiles:

  • Known Activators: Limited to specific compounds in preliminary screens (e.g., selected flavanones or isoflavones) .

  • Antagonists: Flavanone derivatives (e.g., 6,3’-dimethoxyflavanone) may inhibit activity .

Research Applications

Recombinant Tas2r39 is used in:

  1. Bitter Taste Perception Studies:

    • Heterologous expression in HEK293T or CHO cells to test ligand binding and signaling pathways .

  2. Nutrient Sensing:

    • Investigating roles in metabolic regulation, though direct evidence remains sparse .

  3. Comparative Evolutionary Studies:

    • Structural alignment with human TAS2R39 to identify conserved motifs or divergent residues .

Challenges and Future Directions

  • Limited Ligand Data: Few mouse-specific agonists/antagonists have been identified, contrasting with human studies .

  • Functional Redundancy: Overlapping ligand profiles with other Tas2r members (e.g., Tas2r105) complicate specificity analyses .

  • Technological Advances: Cell-free expression systems may enhance high-throughput screening for novel ligands .

Comparative Analysis: Mouse vs. Human TAS2R39

ParameterMouse Tas2r39Human TAS2R39
Ligand BreadthNarrow (restricted agonists)Broad (isoflavones, theaflavins, dipeptides)
Structural FeaturesConserved hydrophobic binding pocketHydrophobic pocket with hydrogen bonding
Expression SitesGustatory tissue, limited extraoral dataColon, bronchi, arteries

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tas2r39; T2r34; Tas2r139; Taste receptor type 2 member 39; T2R39; mT2R34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAQPSNYWKQDVLPLSILMLTLVATECTIGIIASGIVMAVNAVSWVQKKAISITTRILLL LSVSRIGLQSIMLIEITSSIFNVAFYNSVLYRVSNVSFVFLNYCSLWFAALLSFFHFVKI ANFSYPLFFKLKWRISELMPWLLWLSVFISFSSSMFFSKHKFTVNNNNSLSNNICNFTMK LYVVETNVVNVSFLFISGILPPLTMFVATATLLIFSLRRHTLNMRNSATGSRNPCIEAHM QAIKETSCFLFLYILNAAALLLSTSNIVDASLFWSIVIRIVLPVYPAGHSVLLIQNNPGL RRTWKHLQSQIHLYLQNRF
Uniprot No.

Target Background

Function
This protein is a putative taste receptor that may play a role in the perception of bitterness.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is mouse Tas2r39 and what is its role in bitter taste perception?

Mouse Tas2r39 is a member of the taste receptor type 2 family, which functions as G protein-coupled receptors responsible for bitter taste sensing. Mouse Tas2r39 belongs to the larger repertoire of 35 putatively functional Tas2r genes identified in mice . These receptors vary in their tuning breadth, with some receptors like Tas2r105 functioning as generalists that can recognize more than 30% of bitter compounds, while others exhibit narrower agonist profiles .

Mouse bitter taste receptors are expressed in taste buds, primarily in the posterior papillae of the tongue, where they detect potentially harmful bitter compounds in food. The activation of these receptors typically triggers aversive behavioral responses that help mice avoid potentially toxic substances .

How does mouse Tas2r39 compare to human TAS2R39 in terms of sequence homology?

According to commercial protein databases, human TAS2R39 shares approximately 38% sequence identity with its mouse ortholog . This relatively low sequence homology is consistent with the rapid evolution of bitter taste receptors across species, which likely reflects adaptation to different ecological niches and dietary exposures.

What expression patterns does Tas2r39 exhibit in mouse tissues?

While the search results don't provide specific information about Tas2r39 expression patterns, studies have shown that all mouse Tas2r genes are expressed in the gustatory cells of the tongue, particularly in the posterior papillae, albeit at varying levels . Quantitative RT-PCR analyses demonstrate that some receptor mRNAs (like Tas2r108, Tas2r118, Tas2r126, Tas2r135, and Tas2r137) are quite abundant, reaching approximately 20% of the α-gustducin mRNA level, while others (such as Tas2r114, Tas2r122, and Tas2r140) are expressed at much lower levels .

Additionally, recent research has identified Tas2r expression in various extra-oral tissues, suggesting that these receptors may perform functions beyond taste perception . The expression profile of Tas2r39 in these tissues would require specific investigation using techniques such as qRT-PCR or in situ hybridization.

How does the ligand specificity of mouse Tas2r39 compare with other mouse and human bitter taste receptors?

While specific ligand information for mouse Tas2r39 is not detailed in the search results, research has revealed significant differences in bitter compound recognition between mouse and human bitter taste receptors. Of 128 substances tested on both mouse and human bitter taste receptors, 80 (63%) activated mouse Tas2rs and 98 (77%) activated human TAS2Rs, with 72 substances (56%) stimulating receptors in both species .

Human TAS2Rs have varying receptive ranges, with hTAS2R14 responding to 151 known agonists, while five human receptors remain orphan receptors with no identified ligands . In comparison, only about 60% of mouse Tas2rs respond to known agonists (versus 84% of human TAS2Rs) . This highlights the species-specific nature of bitter taste perception systems.

Some human receptors like TAS2R5, TAS2R8, TAS2R13, and TAS2R49 have more synthetic ligands identified, while others like TAS2R1, TAS2R4, TAS2R7, TAS2R39, TAS2R40, TAS2R43, TAS2R44, and TAS2R47 have more natural agonists . To determine the specific agonist profile of mouse Tas2r39, researchers would need to conduct comprehensive deorphanization studies similar to those performed for other Tas2rs.

What roles might Tas2r39 play in extra-oral tissues?

Evidence suggests that bitter taste receptors have significant functions beyond gustatory tissues. Recent studies have demonstrated that Tas2rs modulate innate immune responses and mediate interkingdom signaling through the detection of bacterial products . While specific roles for Tas2r39 are not detailed in the search results, this receptor may participate in similar non-gustatory functions.

Interestingly, the regulation of Tas2r gene expression differs between gustatory and non-gustatory tissues. For example, Tas2r113 and Tas2r124 show high expression in mouse testis but only low to moderate levels in taste tissue, while Tas2r114 exhibits low expression in lingual papillae but robust expression in testis . This differential expression pattern suggests tissue-specific functions that warrant further investigation.

Additionally, many commonly used drugs that have bitter taste properties can activate selected TAS2Rs, including antibiotics (chloramphenicol, erythromycin, and ofloxacin), anti-malarial drugs (quinine and chloroquine), analgesics (acetaminophen), and thyrostatic agents (methimazole and propylthiouracil) . This raises the possibility that Tas2r39 and other bitter taste receptors may mediate some of the off-target effects of these medications.

What signaling mechanisms are associated with mouse Tas2r39 activation?

While specific signaling data for mouse Tas2r39 is not provided in the search results, bitter taste receptors typically couple with gustducin and related G proteins to initiate intracellular signaling cascades. For functional studies of TAS2Rs in heterologous expression systems, researchers often use a Gα16-gust44 chimera to promote functional coupling of activated TAS2Rs with phospholipase C, resulting in calcium release from the endoplasmic reticulum .

This signaling pathway forms the basis for calcium-based assays for measuring TAS2R activation. The canonical bitter taste signaling pathway involves:

  • Binding of bitter compounds to the receptor

  • Activation of gustducin (a G protein)

  • Activation of phospholipase C

  • Production of inositol trisphosphate (IP3)

  • Release of calcium from intracellular stores

  • Activation of the TRPM5 channel

  • Membrane depolarization and signal transduction

What expression systems are recommended for functional studies of mouse Tas2r39?

For functional studies of mouse Tas2r receptors, heterologous expression in mammalian cell lines such as HEK293T cells has proven effective . These systems typically require:

  • Expression of the full-length TAS2R with an N-terminal signal sequence (such as rat somatostatin receptor type 3 signal sequence) to promote receptor translocation to the plasma membrane

  • Co-expression of a Gα16-gust44 chimera for functional coupling with phospholipase C

  • A reporter system to detect calcium release or other downstream signaling events

Research has shown that the choice of G protein chimera significantly affects assay sensitivity. For example, HEK293T cells stably expressing Gα16gust44 provide higher sensitivity for detecting Tas2r activators compared to cells expressing Gα15, particularly for detecting low-efficacy agonists .

What techniques can be used to measure Tas2r39 activation in vitro?

Several approaches can be used to measure activation of bitter taste receptors like Tas2r39:

1. Bioluminescence-based calcium assays:
A bioluminescence-based intracellular calcium release assay has been developed for TAS2Rs in heterologous mammalian cell systems. This approach requires the expression of three key components:

  • Full-length TAS2R with an N-terminal signal sequence

  • Gα16-gust44 chimera for coupling

  • Mt-clytin II (a calcium-dependent luciferase) as the reporter

The optimal vector arrangement places TAS2R and Gα16-gust44 under the control of appropriate promoters (such as CMV or CAG), with divergent orientation between the TAS2R and the other components .

2. Fluorescence-based calcium imaging:
Calcium-sensitive fluorescent dyes or genetically encoded calcium indicators can be used to monitor changes in intracellular calcium levels upon receptor activation.

3. cAMP assays:
Although less common for bitter taste receptors, assays measuring changes in cAMP levels can be used if the receptor couples to Gαs or Gαi.

4. β-arrestin recruitment assays:
These measure receptor activation through the recruitment of β-arrestin, which occurs after receptor phosphorylation.

How can I validate the specificity of Tas2r39 responses in experimental systems?

To validate the specificity of Tas2r39 responses:

  • Use appropriate controls: Include mock-transfected cells and cells expressing other Tas2rs to confirm that responses are specific to Tas2r39.

  • Dose-response experiments: Perform concentration-response studies to determine EC50 values for putative agonists. The search results indicate that type 2 vector constructs (with TAS2R–Gα16-gust44–mt-clytin II arrangement) consistently produce larger assay spans than type 1 vectors (TAS2R–mt-clytin II–Gα16-gust44) .

  • Receptor mutants: Generate receptor mutants with altered binding sites or signaling capabilities to confirm structure-function relationships.

  • Antagonist studies: If available, use specific antagonists to block receptor activation.

  • Genetic approaches: For in vivo validation, consider using CRISPR-Cas9 or other genetic approaches to modify or delete the Tas2r39 gene.

How should I handle contradictory data when studying mouse Tas2r39?

When confronted with contradictory data in Tas2r39 research, consider the following approaches based on mixed methods research principles:

1. Triangulation approach:
Use multiple methods to investigate the same phenomenon, with the expectation that different methods should yield similar results if they are measuring the same underlying reality . If results differ, consider whether:

  • Different methods might be capturing different aspects of the phenomenon

  • There are methodological limitations in one or more approaches

  • The theoretical framework needs revision

2. Complementarity approach:
View different methods as capturing different aspects of a complex reality rather than expecting them to converge on a single truth . This approach accepts that:

  • Qualitative and quantitative data may address different questions

  • Different levels of analysis may reveal different patterns

  • Apparent contradictions may represent complementary perspectives

3. Multi-dimensional accounts:
Construct explanations that integrate seemingly contradictory findings into a more complex understanding of Tas2r39 function . This might involve:

  • Identifying contextual factors that influence receptor behavior

  • Developing multi-level explanations that accommodate different types of data

  • Revising theoretical frameworks to account for complexity

What factors might lead to discrepancies between in vitro and in vivo studies of Tas2r39?

Several factors can contribute to differences between in vitro and in vivo results when studying bitter taste receptors:

  • Expression system differences: Heterologous expression systems may lack accessory proteins or post-translational modifications present in native cells. For example, the choice of G protein chimera significantly affects assay sensitivity, with Gα16gust44 providing higher sensitivity than Gα15 for detecting Tas2r activators .

  • Receptor trafficking: N-terminal signal sequences, such as the rat somatostatin receptor type 3 signal sequence, are often required in heterologous systems to promote receptor translocation to the plasma membrane . Trafficking efficiency may differ between expression systems and native cells.

  • Compound bioavailability: In vivo, compounds must reach their target at sufficient concentrations, which may be affected by absorption, distribution, metabolism, and excretion factors not present in vitro.

  • Complex cellular environments: In vivo, taste receptors function within complex cellular networks and may be influenced by factors not present in isolated systems.

  • Behavioral complexity: Behavioral responses to bitter compounds involve neural processing beyond receptor activation, including learning and contextual factors.

What statistical approaches are appropriate for analyzing Tas2r39 functional data?

For analyzing functional data from Tas2r39 studies, consider the following statistical approaches:

  • Dose-response analysis:

    • Nonlinear regression models to determine EC50 values

    • Four-parameter logistic equations for fitting sigmoid dose-response curves

    • Comparison of maximal response (efficacy) and potency (EC50) values across compounds

  • Multiple comparison corrections:

    • When testing multiple compounds or conditions, apply appropriate corrections (e.g., Bonferroni, Holm-Sidak, or false discovery rate methods)

    • Consider family-wise error rates when conducting multiple hypothesis tests

  • Variability analysis:

    • Account for both biological and technical replicates in experimental design

    • Report data as mean ± standard error of the mean from independent biological replicates

    • Use appropriate statistical tests based on data distribution (parametric vs. non-parametric)

  • Correlation analysis:

    • For structure-activity relationship studies, correlation analyses between chemical properties and receptor activation

    • When comparing receptor responses across species, correlation analyses of activation patterns

What are the key challenges in studying mouse Tas2r39 function?

Several challenges exist in studying mouse Tas2r39 function:

  • Limited deorphanization: While agonists have been identified for 21 of the 35 putatively functional mouse Tas2rs, many receptors remain to be deorphanized . Comprehensive screening of potential ligands is needed to fully characterize the receptive range of mouse Tas2r39.

  • Species differences: The limited sequence homology between mouse and human bitter taste receptors (e.g., 38% for TAS2R39) complicates cross-species extrapolation of findings.

  • Heterogeneity in expression: Mouse Tas2rs show variation in expression levels and patterns, which may reflect functional specialization . Understanding this heterogeneity is crucial for interpreting receptor function.

  • Extra-oral functions: The roles of Tas2rs in non-gustatory tissues are still being elucidated . Determining the specific functions of Tas2r39 in these contexts requires specialized approaches.

How can advanced techniques enhance our understanding of mouse Tas2r39?

Advanced techniques that may enhance Tas2r39 research include:

  • CRISPR-Cas9 genome editing:

    • Generate Tas2r39 knockout models

    • Create reporter lines by knocking in fluorescent proteins under the Tas2r39 promoter, similar to the Tas2r131-CRE/ROSA26-tdRFP approach described for Tas2r131

    • Introduce specific mutations to study structure-function relationships

  • Single-cell transcriptomics:

    • Characterize cell populations expressing Tas2r39 in various tissues

    • Identify co-expressed genes that may function in the same signaling pathway

  • Structural biology approaches:

    • Cryo-electron microscopy to determine receptor structure

    • Molecular dynamics simulations to study ligand binding and receptor activation

  • Optogenetic and chemogenetic tools:

    • Develop tools to specifically activate or inhibit Tas2r39-expressing cells

    • Study the behavioral and physiological consequences of Tas2r39 activation

How does the mouse Tas2r repertoire compare to the human TAS2R family?

The mouse and human bitter taste receptor families show several notable differences:

FeatureMouse Tas2rHuman TAS2RReference
Number of intact genes35 putatively functional25 functional
Number of pseudogenes711
Proportion responding to known agonists60%84%
Highly promiscuous receptorsFewer (e.g., Tas2r105)Several (e.g., TAS2R14 with 151 agonists)
Compound recognition80 out of 128 test compounds98 out of 128 test compounds
Species-specific agonists8 compounds selective for mouse26 compounds selective for human

What insights can comparative studies of mouse and human taste receptors provide?

Comparative studies of mouse and human bitter taste receptors can provide valuable insights into:

  • Evolutionary adaptation: The differences in receptor repertoire and specificity likely reflect adaptation to different diets and environmental toxins.

  • Structure-function relationships: Comparing orthologous receptors with different ligand specificities can help identify key structural determinants of bitter compound recognition.

  • Translational relevance: Understanding species differences is crucial for extrapolating findings from mouse models to human applications, particularly for:

    • Drug development targeting taste receptors

    • Taste masking strategies for bitter medications

    • Understanding metabolic and immune functions of extra-oral taste receptors

  • Precision medicine: Genetic variations in human TAS2R genes, such as polymorphisms in TAS2R31 and TAS2R19, influence bitter compound detection thresholds and intensity ratings . Similar variations likely exist in mouse populations and may affect experimental outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.