Recombinant Mouse Taste receptor type 2 member 40 (Tas2r40)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Taste Receptor Type 2 Member 40 (Tas2r40)

Recombinant Mouse Taste Receptor Type 2 Member 40 (Tas2r40) is a laboratory-engineered form of the Tas2r40 protein, a bitter taste receptor belonging to the G protein-coupled receptor (GPCR) superfamily. This receptor is primarily expressed in taste receptor cells of the tongue and gastrointestinal tract, where it detects bitter compounds and initiates signaling cascades linked to aversion behaviors or metabolic responses . Recombinant versions like Tas2r40 are critical for in vitro studies to elucidate its ligand specificity, structural properties, and physiological roles.

Functional Insights and Signaling Mechanisms

Role in Bitter Taste Perception:

  • Tas2r40 detects structurally diverse bitter compounds, including alkaloids and toxins, through interactions with Gα-gustducin, leading to phospholipase C (PLC) activation and TRPM5-mediated calcium signaling .

Key Agonists and Activation Profiles:

  • Mouse Tas2r40 exhibits species-specific responses. For example, it is activated by bile acids such as lithocholic acid (threshold: 3 µM) but not by ursodeoxycholic acid, unlike its human counterpart TAS2R4 .

  • Broader agonist screens identified Tas2r40 as a "specialist" receptor, responding to fewer compounds compared to generalist receptors like Tas2r105 .

Research Findings and Pharmacological Data

Bile Acid Sensitivity:

  • Tas2r40 is activated by lithocholic acid and taurolithocholic acid at micromolar concentrations (Table 1) .

AgonistThreshold (µM)EC₅₀ (µM)
Lithocholic acid310
Taurolithocholic acid15

Cell Surface Expression:

  • Immunocytochemistry confirms Tas2r40 localizes to the cell membrane in heterologous systems, critical for ligand binding (Table 2) .

ReceptorSurface Expression (Unpermeabilized)Intracellular Expression (Permeabilized)
Tas2r40+

Evolutionary and Functional Divergence:

  • Mouse Tas2r40 lacks orthology to most human TAS2Rs due to lineage-specific expansions, resulting in distinct ligand profiles .

Applications in Research

  • Drug Discovery: Used to screen bitter-masking agents or evaluate off-target effects of pharmaceuticals .

  • Nutrient Sensing: Investigates roles in gut-brain axis signaling and metabolic regulation .

  • Structural Studies: Aids in resolving GPCR activation mechanisms and designing synthetic modulators .

Challenges and Future Directions

  • Low Surface Expression: Tas2r40 requires permeabilization for detection in heterologous systems, complicating functional assays .

  • Ligand Identification: Over 50% of mouse Tas2rs remain "orphan" receptors, necessitating expanded compound libraries for deorphanization .

Recombinant Tas2r40 continues to bridge gaps in taste physiology and GPCR pharmacology, offering insights into interspecies differences and therapeutic targeting .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific requests. Please indicate your desired format in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. Should you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form exhibits a shelf life of 6 months at -20°C/-80°C. Lyophilized form maintains its stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
Tas2r40; T2r33; Tas2r144; Tas2r44; Taste receptor type 2 member 40; T2R40; mT2R33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAIITTNSDYFAHRYEVIIPFVVSTICSIVGIIGNGFITVIYGTEWVRSKRLPTGENLML MLSFSRLLLQIWMMVEITYSLLFPIIYNHNAMYKLFKAISVFLNYCNLWFAAWLNVFYCL KIVNLAHPLFLLMKQKIIGLMPRLLSLSVLVSFSLSSFFSKDILNVYVNTSVPIPSSNST KMKYIFMINVLSLAFLYYMGIFLPLFMFIMAATLLITSLKRHTLHMENSTTGSRDSSMEA HVGAIKSTSHSLILYIINALALFISMSNILGAYSVWNSLCNIIMTAYPAGQSVHLILRNP GLRRAWRRFQHHVHLYLKR
Uniprot No.

Target Background

Function
Gustducin-coupled receptor involved in the detection of bitter compounds in the oral cavity and gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the expression pattern of Tas2r40 in mouse gustatory tissues?

Tas2r40 is expressed in the posterior papillae of the mouse tongue, along with other Tas2r genes. Quantitative RT-PCR (qRT-PCR) analyses demonstrate that all mouse Tas2r genes are expressed in the epithelium of the posterior tongue, though with varying abundance levels. Some receptors like Tas2r108, Tas2r118, Tas2r126, Tas2r135, and Tas2r137 are quite abundant, reaching approximately 20% of the α-gustducin mRNA level, while others such as Tas2r114, Tas2r122, and Tas2r140 are expressed at much lower levels . Although the search results don't specifically mention Tas2r40's relative expression level, researchers investigating this receptor should employ similar qRT-PCR methods to determine its expression pattern relative to other bitter taste receptors.

How does Tas2r40 expression compare at the cellular level versus the tissue level?

Expression patterns of Tas2r genes show good correlation between qRT-PCR data (tissue level) and in situ hybridization experiments (cellular level). Highly expressed receptors like Tas2r118 show pronounced staining in in situ hybridization with many positive cells, while moderately expressed receptors like Tas2r105 and Tas2r138 show fewer stained cells or lower signal intensity . For receptors with low mRNA levels detected by qRT-PCR, only faint signals are typically obtained by in situ hybridization. Researchers working with Tas2r40 should conduct both methods to establish a comprehensive expression profile, as cellular distribution patterns provide important functional insights beyond mere expression levels.

What is known about the subcellular localization of recombinant Tas2r40?

When working with recombinant Tas2r40, researchers should conduct similar immunocytochemistry experiments both before and after permeabilization to determine whether the receptor properly localizes to the cell membrane. This is particularly important because insufficient cell surface expression may prevent successful functional deorphanization of the receptor.

What is the optimal expression system for functional studies of recombinant Tas2r40?

Based on established protocols for other bitter taste receptors, HEK293T cells expressing the chimeric G-protein Gα16gust44 represent an effective heterologous expression system for functional studies of taste receptors. This system has been successfully used for screening bitter compounds against human taste receptors like TAS2R2 .

For mouse Tas2r40 specifically, researchers should:

  • Generate expression constructs with epitope tags (e.g., Rho tag) at the N-terminus to facilitate detection

  • Transiently transfect HEK293T-Gα16gust44 cells

  • Perform calcium mobilization assays to detect receptor activation

  • Include proper empty vector controls to distinguish receptor-mediated responses from non-specific cellular effects

  • Validate cell surface expression using immunocytochemistry before functional experiments

This methodological approach ensures reliable data collection for deorphanization studies and pharmacological characterization of Tas2r40.

How should researchers design a comprehensive screen for Tas2r40 agonists?

A systematic approach to identifying Tas2r40 agonists would follow these methodological steps:

  • Compile a diverse compound library of potential bitter tastants (100+ compounds)

  • Test each compound at two different concentrations:

    • Maximum concentration not causing receptor-independent cellular signals

    • 10-fold dilution of the maximum concentration

  • Select compounds showing fluorescence changes significantly greater than corresponding empty vector controls

  • Confirm receptor responses with dose-response measurements

  • Determine threshold concentrations and, where possible, EC50 values

This methodology follows established protocols for taste receptor deorphanization . When applying this approach to Tas2r40, researchers should pay particular attention to compounds that activate other mouse Tas2r receptors, as there may be overlapping agonist profiles, while still identifying Tas2r40-specific agonists.

What controls are essential when performing calcium imaging experiments with recombinant Tas2r40?

When conducting calcium imaging with recombinant Tas2r40, the following controls are critical:

  • Empty vector transfected cells - to identify non-specific cellular responses to compounds

  • Known functional bitter taste receptor (positive control) - to validate the experimental system

  • Vehicle controls - to account for solvent effects

  • Concentration gradients - to establish dose-response relationships

  • Time controls - to account for potential receptor desensitization in repeated stimulations

Additionally, researchers should verify cell surface expression of the recombinant receptor using immunocytochemistry both before and after permeabilization. This control ensures that negative functional results aren't simply due to trafficking issues, as seen with some taste receptors like Tas2r102 and Tas2r131 that were only detectable after permeabilization .

How can researchers determine the agonist profile breadth of Tas2r40 compared to other mouse bitter taste receptors?

Determining the agonist profile breadth of Tas2r40 requires systematic comparison with other mouse Tas2r receptors. Based on studies of other receptors, researchers should:

  • Screen a large, diverse library of bitter compounds against Tas2r40 and other mouse bitter taste receptors

  • Classify the receptor based on response breadth:

    • Broadly tuned receptors: respond to many structurally diverse agonists

    • Narrowly tuned receptors: respond to few, often structurally related agonists

  • Generate a response matrix showing all tested compounds and their activity against multiple receptors

  • Identify Tas2r40-specific activators that don't stimulate other receptors

This approach would position Tas2r40 within the functional landscape of mouse bitter taste reception. Previous studies have shown that despite partially overlapping agonist profiles, each mouse Tas2r is activated by a unique subset of test substances, with some receptors having specific cognate agonists not detected by other Tas2rs .

What methods should be used to determine concentration-response relationships for Tas2r40 agonists?

For rigorous pharmacological characterization of Tas2r40 agonists, researchers should:

  • Perform calcium mobilization assays with transiently transfected HEK293T-Gα16gust44 cells

  • Test identified agonists across a wide concentration range (typically 10 nM to 1 mM)

  • Plot normalized responses against log concentrations

  • Determine key pharmacological parameters:

    • Threshold concentration (lowest concentration eliciting detectable response)

    • EC50 (concentration producing half-maximal response)

    • Maximum efficacy (maximum response amplitude)

It's important to note that many bitter compounds cannot be applied at signal-saturating concentrations without causing substantial receptor-independent artifacts . Therefore, researchers may need to estimate EC50 values in cases where complete dose-response curves cannot be obtained.

How can researchers investigate structure-activity relationships for Tas2r40 agonists?

To establish structure-activity relationships (SAR) for Tas2r40 agonists, researchers should:

  • Test structurally related compounds from chemical families identified as active on Tas2r40

  • Classify compounds by their chemical superclasses (as done in chemoinformatics approaches)

  • Analyze which structural features correlate with:

    • Activation potency (EC50 values)

    • Activation efficacy (maximum response)

    • Receptor selectivity (activation of Tas2r40 vs. other Tas2rs)

  • Create an alluvial plot similar to those used in chemoinformatics studies , with:

    • Tas2r40 as the primary source

    • Chemical superclasses as the middle nodes

    • Number of receptors targeted as the secondary target

This methodological approach will reveal critical chemical determinants for Tas2r40 activation and help predict additional potential agonists based on structural similarities.

How can genetic diversity in Tas2r40 across mouse strains impact functional studies?

Genetic diversity in taste receptor genes can significantly impact functional studies. While the search results don't provide specific information about Tas2r40 polymorphisms across mouse strains, research on human TAS2R genes shows substantial variation with functional consequences .

Researchers working with Tas2r40 should:

  • Sequence the Tas2r40 gene from different mouse strains used in their research

  • Identify polymorphic sites, particularly nonsynonymous substitutions

  • Assess functional differences using:

    • Calcium imaging with identified agonists

    • Concentration-response relationships

    • Agonist selectivity profiles

  • Use prediction tools like PolyPhen-2 and SIFT to predict the functional impact of nonsynonymous substitutions

This approach will help researchers understand strain-specific differences in bitter taste perception that might affect behavioral or physiological experiments involving Tas2r40.

What methods can be used to compare the function of mouse Tas2r40 with its human ortholog?

To compare mouse Tas2r40 with its human ortholog, researchers should:

  • Identify the human ortholog through sequence homology analysis

  • Clone both receptors with identical epitope tags

  • Express both receptors in the same heterologous system (e.g., HEK293T-Gα16gust44)

  • Screen identical compound libraries against both receptors

  • Compare:

    • Agonist profiles (which compounds activate each receptor)

    • Potency (EC50 values for shared agonists)

    • Efficacy (maximum response amplitudes)

    • Threshold concentrations

This systematic comparison would provide insights into species-specific differences in bitter compound perception and could help identify compounds that might be perceived differently by mice and humans - critical information for translational research.

How should researchers analyze calcium imaging data from Tas2r40 activation experiments?

For robust analysis of calcium imaging data from Tas2r40 activation experiments, researchers should:

  • Calculate fluorescence changes (ΔF/F0) for each cell and each stimulus

  • Normalize responses to a standard agonist or maximum response

  • Apply appropriate statistical tests:

    • Compare receptor responses to empty vector controls

    • Use paired tests for comparing responses in the same cells

    • Apply multiple comparison corrections for large-scale screening data

  • Generate concentration-response curves for identified agonists

  • Calculate threshold concentrations and, where possible, EC50 values

When interpreting the data, researchers should note that different agonists may activate the same receptor with widely different efficacies and potencies, as illustrated by different maximal signal amplitudes, threshold concentrations, and EC50 values observed for other taste receptors .

What approaches can help resolve contradictory data on Tas2r40 activation by specific compounds?

When faced with contradictory data regarding Tas2r40 activation by specific compounds, researchers should:

  • Systematically evaluate experimental variables:

    • Expression system differences (cell line, G-protein coupling)

    • Assay methodology variations (calcium indicator, measurement parameters)

    • Compound purity and solubility issues

    • Receptor construct design (epitope tags, fusion proteins)

  • Perform side-by-side comparisons using:

    • Multiple assay types (calcium imaging, reporter gene assays)

    • Different expression systems

    • Various receptor constructs

    • Positive controls with known activators

  • Consider potential species or strain differences if comparing data from different sources

  • Examine receptor surface expression and trafficking as potential factors affecting functional responses

How can researchers create a functional Tas2r40 knockout model to study its physiological role?

To create and validate a functional Tas2r40 knockout model:

  • Design CRISPR/Cas9-based targeting strategy:

    • Select guide RNAs targeting the Tas2r40 coding region

    • Design homology-directed repair templates with reporters/selection markers

    • Validate editing efficiency in cell lines before moving to animals

  • Generate knockout mice through:

    • Embryonic stem cell modification followed by blastocyst injection

    • Direct zygote injection of CRISPR/Cas9 components

  • Validate the knockout:

    • Genomic PCR and sequencing

    • RT-PCR to confirm absence of mRNA

    • In situ hybridization on taste tissue

    • Immunohistochemistry (if antibodies available)

    • Functional calcium imaging of isolated taste cells

  • Characterize the phenotype through:

    • Behavioral taste preference tests

    • Brief-access licking tests

    • Electrophysiological recordings from taste nerves

    • Calcium imaging of taste cells in response to bitter compounds

This comprehensive approach provides multiple lines of evidence confirming the knockout and its functional consequences.

What approaches can be used to identify intracellular signaling pathways activated by Tas2r40?

To characterize intracellular signaling downstream of Tas2r40 activation:

  • In heterologous expression systems:

    • Co-express Tas2r40 with different G-protein subunits

    • Use BRET/FRET sensors to measure G-protein activation

    • Apply specific signaling pathway inhibitors

    • Measure secondary messengers (calcium, cAMP, IP3)

  • In native taste cells:

    • Isolate taste cells from mice expressing fluorescent markers in Tas2r40-positive cells

    • Perform calcium imaging with various signaling inhibitors

    • Use transgenic mice lacking specific signaling components

    • Apply patch-clamp recording to measure membrane currents

  • For protein-protein interactions:

    • Conduct co-immunoprecipitation of tagged Tas2r40

    • Perform proximity ligation assays

    • Use BRET/FRET to measure dynamic interactions

This multi-method approach will establish the signaling network engaged upon Tas2r40 activation, which may involve the canonical bitter taste pathway (gustducin, PLCβ2, TRPM5) or alternative pathways.

How can researchers investigate the role of Tas2r40 in extraoral tissues?

To examine Tas2r40 expression and function in extraoral tissues:

  • Expression analysis:

    • Conduct qRT-PCR across multiple tissues

    • Perform in situ hybridization on tissue sections

    • Use reporter mice with fluorescent proteins driven by the Tas2r40 promoter

  • Functional studies:

    • Isolate primary cells from tissues showing Tas2r40 expression

    • Perform calcium imaging with potential agonists

    • Compare responses in cells from wild-type vs. Tas2r40 knockout mice

    • Use tissue-specific conditional knockout models

  • Physiological significance:

    • Administer Tas2r40 agonists in vivo and measure physiological responses

    • Compare physiological parameters between wild-type and knockout mice

    • Investigate altered responses to pathogens or toxins in knockout mice

This approach will reveal potential novel roles of Tas2r40 beyond taste perception, similar to bitter taste receptors found in the respiratory, gastrointestinal, and immune systems in humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.