Recombinant Mouse Taste receptor type 2 member 41 (Tas2r41)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Taste Receptor Type 2 Member 41 (Tas2r41)

Recombinant Mouse Tas2r41 is a synthetic version of the bitter taste receptor encoded by the Tas2r41 gene in Mus musculus. As a member of the T2R (TAS2R) receptor family, it belongs to a group of G-protein-coupled receptors (GPCRs) responsible for detecting bitter compounds through gustatory pathways. These receptors are critical for avoiding toxic substances and regulating metabolic responses .

Functional Role and Agonist Identification

Tas2r41 is hypothesized to detect bitter compounds, but specific agonists remain unidentified. Studies on mouse Tas2r receptors suggest functional divergence between species, with orthologs often recognizing distinct ligands .

Current Research Gaps

AspectStatusSource
AgonistsNo physiological ligands identified
Tuning BreadthLikely narrow (specialist receptor)
GI Tract ExpressionLimited data; primarily gustatory focus

Comparative Analysis with Human TAS2R41

FeatureMouse Tas2r41Human TAS2R41
ExpressionTaste cells, possibly GI tractTaste cells, GI tract
AgonistsUndeterminedChloramphenicol (known)
Sequence Identity52%

Note: Human TAS2R41 is activated by chloramphenicol, but mouse orthologs show distinct ligand profiles .

Recombinant Production and Applications

Recombinant Tas2r41 is synthesized via cell-free protein synthesis (CFPS) with a Strep Tag for purification. This approach enables functional studies without relying on native tissue expression .

Expression Patterns

Quantitative RT-PCR and in situ hybridization confirm Tas2r41 mRNA in posterior tongue epithelium, though expression levels are intermediate compared to Tas2r108 or Tas2r118 .

TissueExpression LevelDetection Method
Vallate PapillaeModerateqRT-PCR, in situ hybridization
Ileum/ColonLowRT-PCR (limited data)

Functional Assays

Recombinant Tas2r41 is used in heterologous systems (e.g., HEK293T cells) to screen for agonists. While Tas2r105 (a generalist receptor) responds to >30 compounds, Tas2r41 remains orphan .

Table: Agonist Screening Challenges

ChallengeImpact
Low PotencyMillimolar thresholds for many compounds
Species-Specific LigandsMouse-specific agonists may differ from human
Routing IssuesSome receptors fail membrane localization

Source: Functional comparisons with Tas2r105 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
Tas2r41; Tas2r12; Tas2r126; Tas2r26; Taste receptor type 2 member 41; T2R41; T2R12; T2R26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MLPTLSVFFMLTFVLLCFLGILANGFIVLMLSREWLLRGRLLPSDMILFSLGTSRFFQQC VGLVNSFYYFLHLVEYSGSLARQLISLHWDFLNSATFWFCTWLSVLFCIKIANFSHPAFL WLKWRFPALVPWFLLGSILVSVIVTLLFFWGNHTIYQAFLRRKFTGNTTFKEWNRRLEID YFMPLKVVTMSIPCSLFLVSILLLISSLRRHSLRMQHNTHSLQDPNVQAHSRALKSLISF LVLYAVSFVSMIIDATVFISSDNVWYWPWQIILYFCMSVHPFILITNNLRFRGTFRQLLL LARGFWVA
Uniprot No.

Target Background

Function

Recombinant Mouse Taste receptor type 2 member 41 (Tas2r41) is a receptor potentially involved in bitterness perception and is linked to gustducin. It may also contribute to sensing the gastrointestinal content's chemical composition. Receptor activation may stimulate alpha-gustducin, mediate PLC-beta-2 activation, and subsequently gate TRPM5.

Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.

Q&A

What is the expression pattern of mouse Tas2r41 in gustatory tissue?

Mouse Tas2r41, like other members of the Tas2r family, is expressed in the posterior papillae of the mouse tongue. Quantitative RT-PCR (qRT-PCR) analysis has confirmed expression of all mouse Tas2r genes in the epithelium of the posterior tongue, though with considerable variation in expression levels . The relative expression level of Tas2r41 specifically has not been highlighted in the available data, but the general pattern among Tas2r genes shows that some are quite abundant (reaching ~20% of α-gustducin mRNA levels), while others are rare and barely detectable . To determine the expression pattern of Tas2r41 specifically, researchers should perform qRT-PCR analysis of posterior tongue epithelium, using appropriate primers targeting the Tas2r41 sequence, and compare expression with other Tas2r genes and with α-gustducin as a reference.

How does mouse Tas2r41 compare structurally to human TAS2R41?

Human TAS2R41 encodes a seven trans-membrane receptor protein and shares approximately 52% sequence identity with its mouse ortholog . Both receptors belong to the G-protein coupled receptor superfamily associated with bitter taste perception. The human TAS2R41 gene is clustered together with eight other taste receptor genes on chromosome 7 . For mouse Tas2r41, researchers should note that this moderate sequence identity (52%) suggests potential differences in ligand specificity and downstream signaling pathways between the human and mouse orthologs. Comparative structural analysis should involve sequence alignment of the transmembrane domains, which are typically most conserved across species, and the extracellular loops, which typically determine ligand specificity.

What is known about the agonist profile of mouse Tas2r41?

Based on the available information, the specific agonist profile of mouse Tas2r41 has not been comprehensively characterized. In a broad screening of 34 mouse bitter taste receptors with 128 prototypical bitter substances, researchers identified cognate compounds for 21 receptors, but the specific results for Tas2r41 were not highlighted in the provided data . For comparison, human TAS2R41 responds to chloramphenicol . To determine the agonist profile of mouse Tas2r41, researchers should employ heterologous expression systems (such as HEK293T cells expressing Gα16gust44) and calcium imaging to screen potential bitter compounds. The screening should include chloramphenicol (known to activate human TAS2R41) as well as a diverse library of bitter compounds representing different structural classes.

What expression systems are most effective for studying recombinant mouse Tas2r41?

For functional characterization of mouse Tas2r41, heterologous expression in HEK293T cells stably expressing the chimeric G protein Gα16gust44 is recommended. This system has proven more sensitive than cells expressing only Gα15 for detecting responses from taste receptors with low efficacy activators . The methodology should include:

  • Cloning the full-length mouse Tas2r41 coding sequence into an expression vector

  • Transfecting the construct into HEK293T cells stably expressing Gα16gust44

  • Verifying surface expression through immunocytochemistry or by using epitope tags

  • Performing calcium imaging assays to measure receptor activation upon agonist application

It's important to note that the sensitivity of the assay system significantly impacts detection capabilities, as demonstrated with Tas2r105, where certain agonists were only detected using the Gα16gust44 system but not with Gα15-expressing cells .

How should calcium imaging protocols be optimized for detecting mouse Tas2r41 activation?

Calcium imaging remains the gold standard for functional characterization of bitter taste receptors. For mouse Tas2r41, researchers should:

  • Load transfected cells with a calcium-sensitive dye (e.g., Fluo-4 AM)

  • Establish stable baseline fluorescence before compound application

  • Apply potential agonists at multiple concentrations (typically 0.01 μM to 1 mM) to generate complete concentration-response curves

  • Include positive controls (known bitter compounds activating other Tas2r receptors) and negative controls

  • Calculate threshold concentrations, EC50 values, and maximal response amplitudes to fully characterize receptor pharmacology

The detection system should be sensitive enough to capture both high and low efficacy responses, as mouse bitter taste receptors show widely different efficacies and potencies spanning 6 orders of magnitude in threshold concentrations .

What are the best approaches for confirming the specificity of observed Tas2r41 responses?

To confirm that observed calcium responses are specifically mediated by mouse Tas2r41 activation, researchers should:

  • Include mock-transfected cells (expressing only Gα16gust44) as negative controls

  • Use structurally related compounds to determine chemical specificity

  • Perform site-directed mutagenesis of key residues predicted to be involved in ligand binding

  • Consider using specific antagonists if available

  • Verify results with orthogonal assays such as inositol phosphate accumulation assays

For interpreting results, it's important to consider that many bitter compounds activate multiple Tas2r receptors with different potencies, as seen with compounds like saccharin that activate four different mouse Tas2r receptors at staggered concentrations .

How can one investigate the potential extraoral functions of mouse Tas2r41?

Beyond gustatory tissue, bitter taste receptors have been identified in multiple extraoral tissues. To investigate potential extraoral functions of mouse Tas2r41:

  • Perform comprehensive qRT-PCR tissue profiling to identify Tas2r41 expression in non-gustatory tissues

  • Use in situ hybridization to confirm cellular localization in identified tissues

  • Generate tissue-specific Tas2r41 knockout models using CRISPR/Cas9 technology

  • Evaluate physiological responses to Tas2r41 agonists in identified tissues

  • Consider potential roles in physiological processes such as gut hormone secretion, bronchodilation, or immune responses

Research on other Tas2r genes has shown differential regulation of expression between gustatory and non-gustatory tissues. For example, Tas2r114, which shows low expression in lingual papillae, exhibits robust expression in testis , suggesting tissue-specific regulatory mechanisms that should be considered when investigating extraoral functions of Tas2r41.

What approaches can be used to study the evolution and conservation of Tas2r41 across species?

Evolutionary analysis of Tas2r41 can provide insights into functional conservation and adaptation:

  • Perform phylogenetic analysis using Tas2r41 sequences from multiple species

  • Identify positively selected amino acid residues that may reflect adaptation to different dietary environments

  • Compare agonist profiles of orthologous receptors across species to identify functional divergence

  • Investigate Tas2r41 copy number variations and pseudogenization events across species

  • Correlate receptor tuning properties with ecological niches and dietary preferences

The available data indicates that sequence-orthologous bitter taste receptors may have distinct agonist profiles, suggesting functional divergence despite sequence conservation . For Tas2r41 specifically, understanding its 52% sequence identity with human TAS2R41 would be a starting point for investigating functional conservation and divergence.

How can CRISPR/Cas9 technology be applied to investigate Tas2r41 function in vivo?

CRISPR/Cas9 technology offers powerful approaches for investigating Tas2r41 function:

  • Generate Tas2r41 knockout mice by designing guide RNAs targeting critical exons

  • Create knock-in mice expressing fluorescent reporter proteins under the Tas2r41 promoter for precise cellular localization

  • Introduce specific mutations to study structure-function relationships

  • Develop conditional knockout models to study tissue-specific functions

  • Perform behavioral assays (e.g., brief-access taste tests) to correlate receptor function with avoidance behavior

When designing CRISPR/Cas9 experiments, researchers should consider potential compensatory mechanisms through other Tas2r receptors with overlapping agonist profiles, as many bitter compounds activate multiple receptors .

How do the tuning properties of mouse Tas2r41 compare to other mouse Tas2r receptors?

Mouse Tas2r receptors exhibit diverse tuning properties, ranging from very broadly to extremely narrowly tuned receptors . To place Tas2r41 within this spectrum:

  • Perform side-by-side functional comparison of Tas2r41 with other mouse Tas2r receptors using identical experimental conditions

  • Calculate the response range (percentage of test compounds activating the receptor)

  • Determine if Tas2r41 functions as a "specialist" (responding to 1-3 compounds) or "generalist" (responding to a broader panel)

  • Compare threshold concentrations and EC50 values for shared agonists

  • Identify any Tas2r41-specific agonists that do not activate other receptors

The available data shows that only one mouse Tas2r (Tas2r105) functions as a true generalist, responding to >30% of tested bitter compounds, while other receptors like Tas2r121 (11%), Tas2r135 (9%), and Tas2r144 (16%) show moderate tuning breadth . Understanding where Tas2r41 falls within this spectrum would provide insights into its physiological role.

What can we learn from comparing mouse Tas2r41 with its human ortholog?

Comparative analysis between mouse Tas2r41 and human TAS2R41 can reveal important evolutionary and functional insights:

  • Compare agonist profiles using identical compound libraries and experimental systems

  • Identify conserved and divergent ligand recognition properties

  • Perform comparative structure-function analyses through receptor chimeras or point mutations

  • Correlate functional differences with dietary adaptation and evolutionary history

  • Investigate potential differences in downstream signaling pathways

The available data shows that mouse and human bitter taste receptor orthologs can have distinct agonist profiles despite sequence conservation . For instance, PROP activates six different mouse Tas2r receptors but primarily one human receptor (TAS2R38) . This suggests that careful validation is necessary when extrapolating findings between species.

How reliable are in vitro functional assays for predicting in vivo responses to Tas2r41 agonists?

Correlating in vitro receptor activation with in vivo behavioral responses requires careful consideration:

  • Compare concentration thresholds from heterologous expression systems with behavioral detection thresholds

  • Consider the contribution of multiple Tas2r receptors to the perception of individual bitter compounds

  • Account for potential differences in receptor expression levels between heterologous systems and native taste cells

  • Evaluate the impact of signal transduction components that may modify receptor responses in vivo

  • Perform brief-access taste tests with wild-type and Tas2r41 knockout mice to validate in vitro findings

Research has shown that bitter compounds like saccharin activate multiple mouse Tas2r receptors at staggered concentrations (Tas2r135 at 0.1 mM, Tas2r105 at 1.0 mM, Tas2r109 at 3.0 mM, and Tas2r144 at 10 mM) . This suggests that increasing concentrations in vivo might result in graded bitter responses involving different combinations of receptors, complicating the interpretation of behavioral data.

What factors can affect the expression and function of recombinant mouse Tas2r41?

Several factors can impact the successful expression and functional analysis of recombinant mouse Tas2r41:

  • Codon optimization for the expression system used

  • Addition of N-terminal signal sequences to improve membrane localization

  • Use of epitope tags that don't interfere with receptor function

  • Selection of appropriate vector and promoter for optimal expression levels

  • Co-expression with chaperone proteins to improve folding and trafficking

Additionally, bitter taste receptors may exhibit constitutive activity or desensitization, which can complicate functional assays. Proper controls and optimization of expression conditions are essential for reliable results.

How can discrepancies between different functional assays for Tas2r41 be resolved?

When facing inconsistent results from different assay systems:

  • Compare the sensitivity of different G protein coupling systems (Gα15 vs. Gα16gust44)

  • Evaluate the impact of different calcium indicators on detection sensitivity

  • Consider the temporal resolution of the detection system relative to receptor kinetics

  • Assess potential interference from endogenous receptors in the expression system

  • Validate key findings using multiple orthogonal assays (calcium imaging, inositol phosphate accumulation, β-arrestin recruitment)

The literature demonstrates that assay sensitivity significantly impacts detection capabilities. For example, when Tas2r105 was assessed with different G proteins, low efficacy activators resulted in lower or absent responses in Gα15-expressing cells compared to the Gα16gust44 system .

What are the key considerations for designing knockout or reporter mouse models for Tas2r41 research?

When developing genetic mouse models for Tas2r41 research:

  • Carefully evaluate the potential for compensatory upregulation of other Tas2r genes

  • Consider the clustered genomic organization of Tas2r genes and potential regulatory elements

  • Design targeting strategies that minimize disruption of neighboring genes

  • Include appropriate reporter systems (e.g., fluorescent proteins) for tracking expression

  • Validate knockout models at DNA, RNA, and protein levels

Researchers should be aware that Tas2r genes show heterogeneous expression patterns, with significant variation in the number of cells expressing each receptor and in expression levels . This heterogeneity should be considered when interpreting results from reporter mouse models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.