Recombinant Mouse TBC1 domain family member 20 (Tbc1d20)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Tbc1d20; TBC1 domain family member 20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-402
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tbc1d20
Target Protein Sequence
MALRPSKGDGSAGRWDRGAGKADFNAKRKKKVAEIHQALNSDPIDLAALRRMAISEGGLL TDEIRCQVWPKLLNVNTSEPPPVSRKDLRDMSKDYQQVLLDVRRSLRRFPPGMPDEQREG LQEELIDIILLVLDRNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPT MDNTKHILNYLMPIIDQVSPELHDFMQSAEVGTIFALSWLITWFGHVLMDFRHVVRLYDF FLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQ FPPSELAREAAAQQEAERTAASTFKDFELASTQQRPDMVLRQRFRGLLRPEARTKDVLTK PRTNRFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP
Uniprot No.

Target Background

Function

GTPase-activating protein specific for Rab1 and Rab2 small GTPase families. It significantly accelerates their intrinsic GTP hydrolysis rate by more than five orders of magnitude.

Gene References Into Functions
  1. TBC1D20 plays a crucial role in autophagosome maturation. PMID: 27487390
  2. Disruption of Tbc1d20 in mice leads to cataracts and abnormal acrosomal formation. PMID: 25476608
  3. Loss-of-function TBC1D20 mutations cause cataracts and male infertility in mice and Warburg Micro syndrome in humans. PMID: 24239381
Database Links
Involvement In Disease
Defects in Tbc1d20 are the cause of spontaneous autosomal recessive blind sterile (bs) phenotype. Bs animals exhibit embryonic non-progressive nuclear cataracts and spermatid abnormalities associated with male infertility.
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of TBC1D20 protein in mouse models?

TBC1D20 functions primarily as a GTPase-activating protein (GAP) that increases the intrinsically slow GTP-hydrolysis rate of small RAB-GTPases, converting them from their "active" GTP-bound state to the "inactive" GDP-bound state. Biochemical studies have established TBC1D20 as a GAP for multiple targets:

Primary TargetsSecondary TargetsRecently Identified Target
RAB1BRAB2ARAB11
RAB18

The protein is localized to the endoplasmic reticulum (ER) as a type II membrane protein with the catalytically active TBC domain positioned in the cytosol. Through its GAP function, TBC1D20 regulates various cellular processes including autophagosome maturation, vesicle trafficking, and organelle homeostasis .

How does the blind sterile (bs) mouse model help in studying TBC1D20 function?

The blind sterile (bs) mouse carries a spontaneous autosomal-recessive mutation in the Tbc1d20 gene, making it an invaluable model for studying TBC1D20 function. These mice exhibit:

  • Nuclear cataracts (ocular phenotype)

  • Male infertility (reproductive phenotype)

  • Adult-onset motor dysfunction (neurological phenotype)

This model allows researchers to investigate the in vivo consequences of TBC1D20 deficiency and draw parallels with human Warburg Micro syndrome. Functional assays using bs mouse embryonic fibroblasts (MEFs) reveal:

  • Accumulation of SQSTM1-positive bodies

  • Disrupted autophagic flux

  • Enlargement of Golgi apparatus

  • Aberrant lipid droplet formation

The bs mouse provides a powerful tool for investigating the tissue-specific requirements of TBC1D20, particularly in lens, testis, brain, and uterine tissues .

What phenotypes are observed in TBC1D20-deficient mice?

TBC1D20-deficient mice display multiple tissue-specific abnormalities that parallel certain aspects of human Warburg Micro syndrome:

Tissue/SystemPhenotypic Abnormalities
EyesCongenital cataracts, disrupted lens fiber cell homeostasis
Reproductive system (male)Infertility, disrupted blood-testis barrier integrity, impaired acrosome formation
Reproductive system (female)Infertility, impaired postnatal uterine development, reduced endometrial gland formation
Nervous systemAdult-onset motor dysfunction, disrupted neuronal autophagic flux
Cellular levelImpaired autophagosome maturation, accumulation of lipid droplets

Notably, while TBC1D20-deficient mice don't fully recapitulate the severe developmental brain abnormalities of WARBM4 patients, they do display disrupted neuronal autophagic flux resulting in motor impairment .

How can I verify the functional activity of recombinant mouse TBC1D20 protein?

To verify the functional activity of recombinant mouse TBC1D20 protein, employ a multi-faceted approach:

  • GAP activity assay: Measure the GTP hydrolysis rate of purified RAB1B, RAB2A, or RAB18 proteins in the presence of recombinant TBC1D20. A functional TBC1D20 will accelerate the conversion of GTP to GDP.

  • Binding assays: Perform pull-down experiments to confirm physical interaction between TBC1D20 and its target RABs. Co-immunoprecipitation can be used with cell lysates expressing tagged versions of both proteins.

  • Cell-based assays: Introduce recombinant TBC1D20 into TBC1D20-deficient cells (such as bs MEFs) and assess:

    • Autophagosome maturation (using LC3-II/LC3-I ratio)

    • SQSTM1/p62 levels (by immunoblotting)

    • ER stress markers (BIP, PDI)

    • Golgi morphology (by immunofluorescence)

A functionally active recombinant TBC1D20 should rescue the cellular phenotypes observed in TBC1D20-deficient cells .

How does TBC1D20 regulate autophagosome maturation and what experimental approaches can demonstrate this role?

TBC1D20 serves as a key regulator of autophagosome maturation through its RAB1B GAP function. The current model proposes that TBC1D20-mediated inactivation of RAB1B is essential for autophagosome maturation and maintenance of autophagic flux. To experimentally demonstrate this role:

  • Autophagy flux assays:

    • Measure LC3-II accumulation with and without lysosomal inhibitors (e.g., bafilomycin A1) in cells expressing wild-type vs. mutant TBC1D20

    • Monitor degradation of long-lived proteins labeled with radioisotopes

    • Assess SQSTM1/p62 clearance rates

  • Microscopy-based approaches:

    • Perform live-cell imaging using tandem fluorescent-tagged LC3 (mRFP-GFP-LC3) to distinguish autophagosomes from autolysosomes

    • Use electron microscopy to quantify autophagosome and autolysosome numbers and morphology

    • Conduct co-localization studies of autophagosomes (LC3), lysosomes (LAMP1), and RAB1B

  • Molecular manipulation strategies:

    • Express catalytically inactive TBC1D20 mutants to determine if GAP activity is essential for autophagosome maturation

    • Generate RAB1B constitutively active (Q67L) or dominant negative (S22N) mutants to determine if they phenocopy TBC1D20 deficiency or overexpression

Data from TBC1D20-deficient cells show increased percentage of LC3-positive area, accumulation of SQSTM1, and disrupted autophagosome-lysosome fusion, supporting TBC1D20's critical role in autophagosome maturation .

What is the relationship between TBC1D20 and RAB proteins in different cellular contexts, and how can this be experimentally investigated?

TBC1D20 regulates multiple RAB proteins in different cellular contexts, with tissue-specific consequences. The experimental investigation of these relationships requires sophisticated approaches:

  • Biochemical characterization:

    • Conduct systematic GAP activity assays against a panel of RAB proteins to identify all potential targets

    • Determine binding affinities using surface plasmon resonance or isothermal titration calorimetry

    • Perform structural studies (X-ray crystallography, cryo-EM) of TBC1D20-RAB complexes

  • Tissue-specific analyses:

    • Generate conditional knockout models with tissue-specific Cre drivers to isolate TBC1D20 function

    • Perform quantitative proteomics on different tissues from wild-type and TBC1D20-deficient mice to identify altered RAB activation states

    • Use proximity labeling approaches (BioID, APEX) to identify tissue-specific TBC1D20 interactors

  • Advanced imaging techniques:

    • Employ FRET-based RAB activity sensors to monitor RAB activation dynamics in living cells

    • Use super-resolution microscopy to visualize TBC1D20 and RAB co-localization at nanoscale resolution

    • Apply correlative light and electron microscopy to connect RAB localization with ultrastructural features

Recent research has expanded TBC1D20's known targets to include RAB11, implicating TBC1D20 in coordinating vesicle transport and actin remodeling during ciliogenesis, in addition to its established roles with RAB1B, RAB2A, and RAB18 .

How can researchers effectively study the impact of TBC1D20 on cellular stress responses, particularly endoplasmic reticulum stress?

TBC1D20 deficiency triggers endoplasmic reticulum (ER) stress in multiple cell types. To effectively study this relationship:

  • ER stress marker analysis:

    • Quantify expression levels of key ER stress markers (BIP/GRP78, PDI, CHOP, XBP1 splicing) using RT-qPCR, western blotting, and immunofluorescence

    • Monitor activation of ER stress sensor proteins (IRE1α, PERK, ATF6) through phosphorylation status and cellular localization

    • Assess downstream consequences including calcium homeostasis disruption using fluorescent calcium indicators

  • Rescue experiments:

    • Test whether chemical chaperones (e.g., 4-PBA, TUDCA) can alleviate ER stress in TBC1D20-deficient cells

    • Determine if modulating RAB1B or RAB18 activity can rescue ER stress phenotypes

    • Express domain-specific TBC1D20 mutants to identify regions critical for ER homeostasis

  • Transcriptomic and proteomic analyses:

    • Perform RNA-seq on TBC1D20-deficient vs. wild-type cells to identify global transcriptional changes in ER stress pathways

    • Use quantitative proteomics to detect alterations in ER-resident protein abundance and post-translational modifications

    • Analyze secretory pathway function through pulse-chase experiments measuring protein trafficking rates

Research in uterine stromal cells revealed that TBC1D20 deficiency leads to significant decreases in BIP and PDI expression during both proliferative and differentiation phases, indicating severe ER stress that contributes to impaired decidualization and cell cycle progression .

What are the molecular mechanisms behind tissue-specific phenotypes in TBC1D20-deficient mice, and how can these be dissected experimentally?

The tissue-specific phenotypes in TBC1D20-deficient mice (eye, testis, brain, uterus) suggest context-dependent functions that can be dissected using sophisticated experimental approaches:

  • Tissue-specific molecular profiling:

    • Perform single-cell RNA-seq on affected tissues to identify cell populations most impacted by TBC1D20 deficiency

    • Use spatial transcriptomics to map gene expression changes within tissue architecture

    • Conduct comparative proteomics across tissues to identify common and tissue-specific alterations

  • Cell type-specific rescue strategies:

    • Generate transgenic mice with cell type-specific expression of TBC1D20 on the bs background

    • Use viral vectors with cell type-specific promoters to restore TBC1D20 expression in selected populations

    • Perform ex vivo culture of affected tissues with recombinant TBC1D20 protein delivery

  • Detailed phenotypic analyses:

    • For eye phenotypes: Track lens fiber cell differentiation, protein aggregation dynamics, and oxidative stress markers

    • For testicular defects: Analyze blood-testis barrier integrity using tracer molecules and assess Sertoli cell maturation markers (SOX9, WT1)

    • For uterine abnormalities: Evaluate stromal cell proliferation with EdU incorporation assays and measure decidualization markers (BMP2, WNT4)

Research has revealed distinct mechanisms in different tissues:

  • In the lens: TBC1D20 maintains transparency by facilitating autophagy-mediated removal of damaged proteins and organelles

  • In testes: TBC1D20 regulates Sertoli cell maturation and blood-testis barrier integrity

  • In uterus: TBC1D20 is essential for proper endometrial gland formation and decidualization capacity .

How can researchers develop and validate RAB-specific TBC1D20 mutants for investigating pathway-specific functions?

Developing RAB-specific TBC1D20 mutants is crucial for dissecting the protein's multiple functions. This requires a systematic approach:

  • Structure-guided mutagenesis:

    • Utilize structural information about TBC1D20-RAB interfaces to design mutations that selectively disrupt interaction with specific RABs

    • Target catalytic residues within the TBC domain that may have differential effects on various RAB substrates

    • Create chimeric proteins by swapping domains with other TBC-domain proteins that have different RAB specificities

  • In vitro validation:

    • Perform comprehensive GAP activity assays against all known TBC1D20 target RABs for each mutant

    • Conduct binding studies using purified proteins to confirm altered interaction patterns

    • Use structural analyses (hydrogen-deuterium exchange mass spectrometry, NMR) to confirm conformational changes

  • Cellular validation strategies:

    • Express mutants in TBC1D20-deficient cells and assess rescue of phenotypes associated with specific RAB pathways:

      • RAB1B pathway: ER-to-Golgi trafficking, Golgi morphology

      • RAB18 pathway: Lipid droplet formation, ER structure

      • RAB11 pathway: Ciliogenesis, actin cytoskeleton organization

    • Use proximity labeling approaches to confirm altered protein interaction networks for each mutant

  • In vivo validation:

    • Generate knock-in mouse models expressing RAB-specific TBC1D20 mutants

    • Analyze whether certain tissue phenotypes are rescued while others persist, establishing RAB-tissue relationships

This approach would help resolve whether RAB1B regulation primarily affects autophagy, RAB18 regulation impacts lipid homeostasis, and RAB11 regulation influences ciliogenesis and actin remodeling .

What methodologies can be used to investigate the potential role of TBC1D20 in viral replication and pathogenesis?

TBC1D20 has been implicated in viral replication, particularly for hepatitis C virus (HCV) and potentially HIV. To investigate this role:

  • Viral infection models:

    • Compare viral replication efficiency in wild-type vs. TBC1D20-deficient cells for multiple viruses

    • Use TBC1D20 conditional knockout mice to assess in vivo susceptibility to viral infection

    • Examine viral entry, replication, assembly, and release in cells expressing wild-type vs. mutant TBC1D20

  • Protein-protein interaction analyses:

    • Perform co-immunoprecipitation of TBC1D20 with viral proteins to identify direct interactions

    • Use yeast two-hybrid or mammalian two-hybrid systems to map interaction domains

    • Conduct in vitro binding assays with purified recombinant proteins to confirm direct interactions

  • Subcellular localization studies:

    • Track changes in TBC1D20 localization during viral infection using fluorescence microscopy

    • Monitor co-localization of TBC1D20 with viral replication complexes

    • Examine whether viral proteins alter TBC1D20's interaction with or regulation of RAB GTPases

  • Functional rescue experiments:

    • Test whether expression of TBC1D20 with mutations in key functional domains can rescue viral replication in TBC1D20-deficient cells

    • Determine if pharmacological modulation of downstream pathways can bypass the requirement for TBC1D20

Previous research has established that TBC1D20 and its cognate GTPase, RAB1, bind to the nonstructural protein 5A (NS5A) of HCV to mediate viral replication. Depletion of TBC1D20 inhibits both viral replication and HCV infection, suggesting it could be a potential therapeutic target .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.