Recombinant Mouse Tetraspanin-12 (Tspan12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tspan12; Tm4sf12; Tetraspanin-12; Tspan-12; Transmembrane 4 superfamily member 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tspan12
Target Protein Sequence
MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGTLLVIFCVELACGVWTYEQEVM VPVQWSDMVTLKARMTNYGLPRYRWLTHAWNYFQREFKCCGVVYFTDWLEMTEMDWPPDS CCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMIL TITLLWALYYDRREPGTDQMLSLKNDTSQHLSCHSVELLKPSLSRIFEHTSMANSFNTHF EMEEL
Uniprot No.

Target Background

Function
Tetraspanin-12 (Tspan12) is a regulator of cell surface receptor signal transduction. It acts as a regulator of membrane proteinases, including ADAM10 and MMP14/MT1-MMP. Tspan12 activates ADAM10-dependent cleavage activity of amyloid precursor protein (APP) and MMP14/MT1-MMP-dependent cleavage activity. Tspan12 plays a crucial role in retinal vascularization by regulating norrin (NDP) signal transduction. It collaborates with norrin (NDP) to promote FZD4 multimerization and subsequent activation of FZD4, leading to increased beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. Notably, Tspan12 only activates the norrin (NDP)-dependent activation of FZD4, but not the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling pathway that also promotes beta-catenin (CTNNB1) accumulation.
Gene References Into Functions
  1. TSPAN12 promotes chemoresistance and proliferation of small cell lung carcinoma under the regulation of miR-495. PMID: 28302484
  2. Data indicate that Norrin multimers and TSPAN12 cooperatively promote multimerization of FZD4 and its associated proteins to elicit physiological levels of signaling. PMID: 19837033
Database Links

KEGG: mmu:269831

UniGene: Mm.21950

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the neonatal retinal vasculature but not other retinal tissues. Also detected in the neonatal meningeal vasculature and in nonvascular cell types, such as the smooth muscle cells in the neonatal intestine.

Q&A

What is the molecular structure of TSPAN12?

TSPAN12 belongs to the tetraspanin protein family, characterized by four transmembrane domains and two extracellular loops . Like other tetraspanins, it acts as a signaling platform by forming tetraspanin-enriched microdomains (TEMs) in the plasma membrane . The protein contains highly conserved residues that are crucial for its function, particularly in the extracellular domains that mediate protein-protein interactions .

What are the primary biological functions of TSPAN12?

TSPAN12 serves multiple biological functions across different tissues. It is essential for retinal vascular development through regulation of Norrin-induced β-catenin signaling by cooperating with FZD4 and LRP5 receptors . Additionally, TSPAN12 functions as a negative regulator of aldosterone production in adrenal glands and plays roles in cancer progression by enhancing cancer-stromal cell interactions and promoting β-catenin-mediated CXCL6 secretion .

How does TSPAN12 contribute to retinal vascular development?

TSPAN12 is critical for proper retinal angiogenesis and maintenance of the blood-retinal barrier . It directly binds to Norrin with high affinity in a lipid environment and forms a complex with FZD4 . This TSPAN12/FZD4 heterodimer more efficiently captures Norrin than FZD4 alone, particularly at low Norrin concentrations . The interaction enhances Norrin-β-catenin signaling, which directs proper vascular network formation in the retina .

How does TSPAN12 participate in the Norrin-β-catenin signaling pathway?

TSPAN12 directly captures Norrin upstream of signaling rather than allosterically enhancing FZD4 binding to Norrin or Dishevelled (Dvl) . TSPAN12 and FZD4 can simultaneously bind Norrin, forming a ternary complex that enhances signaling efficiency . Importantly, TSPAN12 competes with both heparan sulfate proteoglycans and LRP6 for Norrin binding, suggesting a complex regulatory mechanism for fine-tuning signaling strength . Mutations that disrupt this function lead to defects in retinal vascular development .

What is the role of TSPAN12 in cancer progression?

TSPAN12 contributes to cancer progression through interactions with the tumor microenvironment. It mediates cancer-stromal cell contact and enhances cancer cell invasion and proliferation . When TSPAN12 is upregulated in fibroblasts (particularly those with p53 depletion), it orchestrates both cell-to-cell contact-dependent signaling and paracrine signaling through increased CXCL6 secretion via β-catenin pathway activation . Studies have shown that TSPAN12 supports human breast cancer growth and is involved in tumor progression .

How does TSPAN12 regulate aldosterone production?

TSPAN12 functions as a negative regulator of aldosterone production in adrenal glands . Its expression levels in aldosterone-producing adenomas (APAs) are inversely correlated with baseline plasma aldosterone concentrations . Under conditions of renin-angiotensin system activation (such as low-salt diet), TSPAN12 expression increases in the zona glomerulosa layer of the adrenal cortex . Angiotensin II stimulation of human adrenocortical cells increases TSPAN12 expression through calcium-dependent pathways, and gene silencing of TSPAN12 enhances aldosterone secretion .

What techniques are used to study TSPAN12 expression patterns?

Researchers employ multiple complementary approaches to study TSPAN12 expression:

  • RNA-seq and microarray analysis for transcriptome profiling across tissues and disease states

  • Quantitative PCR (qPCR) for measuring mRNA expression levels

  • Immunohistochemistry for protein localization in tissues, such as in the zona glomerulosa of adrenal glands

  • Western blotting for protein expression quantification and stability assessment of wild-type versus mutant TSPAN12

  • In situ hybridization for spatial expression patterns in developing tissues

How can TSPAN12 protein-protein interactions be analyzed?

Several methodological approaches are valuable for studying TSPAN12 interactions:

  • Co-immunoprecipitation using epitope-tagged TSPAN12 constructs to identify binding partners

  • Luciferase reporter assays in cell lines (e.g., SuperTopFlash cells) to assess functional interactions in Norrin-β-catenin signaling

  • Direct binding assays with purified proteins in lipid environments to measure interaction affinities

  • Immunofluorescence co-localization studies to visualize interactions in cellular contexts

  • Proximity ligation assays for detecting protein interactions with spatial resolution

What types of TSPAN12 mutations are associated with retinal disorders?

Multiple TSPAN12 mutations have been identified in patients with Familial Exudative Vitreoretinopathy (FEVR) . These include:

  • Missense mutations affecting conserved residues (e.g., c.566G>A/p.C189Y, c.C254T/p.T85M)

  • Frameshift mutations causing truncated proteins (e.g., c.177delC/p.Y59fsX67)

  • Mutations in transmembrane domains (e.g., L101H, C105R, A237P)

Functional studies show these mutations impair TSPAN12's ability to enhance Norrin-induced β-catenin signaling .

What phenotypes result from TSPAN12 mutations in the retina?

Patients with TSPAN12 mutations exhibit characteristic ocular phenotypes including:

  • Increased ramification of peripheral retinal vessels

  • Peripheral avascular zones

  • Inferotemporal dragging of the optic disc and macula

  • Retinal folds

The severity of retinopathy varies, with probands often showing more severe manifestations while family members carrying the same mutation may be asymptomatic .

How can TSPAN12 mutations be functionally characterized?

Functional characterization of TSPAN12 mutations involves:

  • Site-directed mutagenesis to introduce mutations into wild-type TSPAN12 cDNA

  • Expression of mutant constructs in appropriate cell lines (e.g., Cos7 cells)

  • Western blot analysis to assess protein stability and expression levels

  • Luciferase reporter assays in STF cells to measure effects on Norrin-β-catenin signaling

  • Immunofluorescence to determine subcellular localization of mutant proteins

These approaches have demonstrated that TSPAN12 mutations associated with FEVR result in defective Norrin/β-catenin signaling .

How can TSPAN12 function be assessed in cancer models?

To study TSPAN12's role in cancer progression, researchers have employed these methodological approaches:

  • Coculture systems with cancer cells and stromal fibroblasts to monitor enhancements in invasiveness and proliferation

  • siRNA-mediated knockdown of TSPAN12 to assess its requirement for cancer-stromal cell interactions

  • Analysis of β-catenin signaling and downstream target gene expression (e.g., CXCL6)

  • Correlation of TSPAN12 expression with clinical parameters in cancer patient samples

  • Investigation of p53-mediated regulation of TSPAN12 expression in the tumor microenvironment

What experimental models are suitable for studying TSPAN12 in vascular development?

Several model systems are valuable for investigating TSPAN12's role in vascular development:

  • Genetically modified mouse models (knockout or conditional knockout of TSPAN12)

  • Porcine models with controlled dietary conditions to modulate the renin-angiotensin system

  • In vitro cell culture systems using human adrenocortical cell lines (e.g., HAC15) for mechanistic studies

  • Luciferase reporter assays in STF cells to reconstitute and manipulate the Norrin-β-catenin signaling pathway

  • Biochemical studies with purified proteins in lipid environments to study direct binding interactions

What therapeutic strategies might target TSPAN12?

Based on current understanding of TSPAN12 biology, several therapeutic approaches could be considered:

  • Recombinant soluble extracellular region of TSPAN12 as a potential therapeutic agent for cancer

  • Antibodies against TSPAN12 to modulate its function in cancer progression

  • Targeting the TSPAN12-CXCL6 axis in cancer therapy

  • Small molecules that enhance or inhibit TSPAN12-Norrin interactions for treating retinal vascular disorders

  • Gene therapy approaches to correct TSPAN12 mutations or modulate its expression in FEVR patients

What expression systems are optimal for producing recombinant mouse TSPAN12?

For functional studies of recombinant mouse TSPAN12:

  • Mammalian expression systems (e.g., HEK293, Cos7 cells) provide proper post-translational modifications and folding

  • Transfection with epitope-tagged constructs (e.g., Flag, Myc) facilitates detection and purification

  • Stable cell lines expressing TSPAN12 may be created for consistent protein production

  • Coexpression with interaction partners (FZD4, LRP5) may enhance proper folding and function

How should functional assays for recombinant TSPAN12 be designed?

When designing functional assays for recombinant TSPAN12:

  • SuperTopFlash (STF) cell line transfection with wild-type or mutant TSPAN12 allows measurement of Norrin-induced luciferase reporter activity

  • Co-transfection with FZD4, LRP5, and Norrin expression vectors reconstitutes the complete signaling pathway

  • Controls should include empty vector transfections and known functional/non-functional TSPAN12 variants

  • Protein expression levels should be verified by Western blotting to ensure comparable expression between constructs

  • Both wild-type and mutant proteins should be tested for stability and cellular localization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.