Recombinant Mouse Tetraspanin-14 (Tspan14)

Shipped with Ice Packs
In Stock

Description

Table 1: Recombinant Mouse Tspan14 Variants

Catalog #Host SystemTagLengthSource
RFL33851MF E. coliHis1-270Creative BioMart
11552-TS HEK293Fc Chimera114-232R&D Systems
MBS7032261 Cell-freeNot specifiedFullMyBioSource

Production and Purification

Recombinant Mouse Tspan14 is produced using multiple expression systems:

  • Prokaryotic (E. coli): Used for cost-effective, high-yield production of full-length protein with N-terminal His tags .

  • Mammalian (HEK293): Preferred for post-translational modifications (e.g., glycosylation) and functional studies .

  • Cell-free systems: Enable rapid production for structural studies .

Functional Insights

Mouse Tspan14 interacts with ADAM10, a metalloprotease, to regulate its maturation and substrate specificity :

  • ADAM10 Regulation:

    • Promotes ADAM10-mediated cleavage of CDH5 (cadherin-5) .

    • Inhibits ADAM10-dependent GP6 cleavage .

  • Pathway Involvement:

    • Modulates Notch signaling via ADAM10 trafficking .

    • Associates with integrins and cholesterol in migrasomes, influencing cell migration .

Table 2: Key Functional Roles

FunctionMechanismCitation
ADAM10 maturationEnhances cell surface expression
Notch signaling regulationFacilitates ligand-receptor cleavage
Migrasome formationIntegrates with TSPAN4/cholesterol

4.1. Disease Models

  • Cancer: Low Tspan14 expression correlates with increased invasiveness in NSCLC (non-small cell lung cancer) cell lines . Silencing Tspan14 elevates MMP2/9 expression, enhancing extracellular matrix degradation .

  • Vascular Biology: Tspan14-containing migrasomes mediate endothelial cell repair and angiogenesis .

4.2. Tools and Assays

  • ELISA Kits: Detect Tspan14 in serum/plasma with a sensitivity of 40.9 pg/mL .

  • Cell Lysates: HEK293-derived lysates (e.g., TSPAN14-712HCL) enable Western blot validation .

Future Directions

Emerging studies highlight Tspan14’s role in extracellular vesicle (EV) biogenesis and immune modulation . Its interaction with ADAM10 positions it as a therapeutic target for cancers and neurodegenerative disorders . Further structural studies on the LEL domain could elucidate mechanisms of TEM assembly .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we currently have in stock, we are happy to accommodate special format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Tspan14; D14Ertd226e; Tm4sf14; Tetraspanin-14; Tspan-14; Transmembrane 4 superfamily member 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tspan14
Target Protein Sequence
MHYYRYSNAEVSCWYKYLLFSYNIVFWLAGVVFLGVGLWAWSEKGVLSDLTKVTRLHGID PVVLVLMVGVVMFTLGFAGCVGALRENICLLKFFCGAIVLIFFLELAVAVLAFLFQDWVR DRFREFFESNIKSYRDDIDLQNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKC GVPFSCCVPDPAQKVVNTQCGYDVRIQLKSKWDEFIFTKGCIQALEGWLPRNIYIVAGVF IAISLLQIFGIFLARTLISDIEAVKAGHHF
Uniprot No.

Target Background

Function
Recombinant Mouse Tetraspanin-14 (Tspan14) regulates the maturation and trafficking of the transmembrane metalloprotease ADAM10. It negatively regulates ADAM10-mediated cleavage of GP6 while promoting ADAM10-mediated cleavage of CDH5.
Database Links

KEGG: mmu:52588

UniGene: Mm.28876

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Tetraspanin-14 (Tspan14) and how is it structurally organized?

Tspan14 is a transmembrane protein belonging to the tetraspanin family, which is characterized by four transmembrane domains and two extracellular loops. The protein contains a large extracellular domain (EC2) that is often the focus of recombinant protein studies, similar to other tetraspanins that can be expressed as fusion proteins with carriers such as glutathione S-transferase (GST) . Current research indicates that Tspan14 belongs to the TspanC8 subfamily, which has been studied across species including C. elegans, where the TSP-14 locus encodes two major protein isoforms (TSP-14A and TSP-14B) that differ by only 24 amino acids at their N-termini . This structural organization influences its subcellular localization and functional interactions with other proteins.

How does Tspan14 function differ from other tetraspanins?

While tetraspanins share structural similarities, they exhibit distinct functional properties. Unlike some more extensively studied tetraspanins such as CD9, CD63, CD81, and CD151, which have established roles in viral infection processes and cellular signaling , Tspan14's unique functions are still being elucidated. Different tetraspanin family members can either promote or suppress tumor progression , suggesting context-dependent roles.

In C. elegans, TSP-14 isoforms demonstrate unique subcellular distribution patterns, with TSP-14A localizing to apical intracellular vesicles and TSP-14B localizing to the plasma membrane on the basolateral side . This differential localization likely contributes to isoform-specific functions that may be conserved in mammalian systems including mouse. Unlike certain tetraspanins that function predominantly at the cell surface, Tspan14 may have significant intracellular roles depending on the isoform expressed.

What expression patterns does Tspan14 exhibit in normal mouse tissues?

Tspan14 expression in normal tissues provides important baseline data for comparative studies. While comprehensive tissue-specific expression data for mouse Tspan14 is limited in the provided sources, research approaches similar to those used for human TSPAN14 can be applied. Flow cytometry analysis using specific antibodies against Tspan14 can quantify expression levels across different cell types and tissues .

For accurate tissue expression profiling, researchers should employ quantitative techniques similar to those used in NSCLC studies, where mean fluorescence intensity (MFI) measurements were utilized to establish that TSPAN14 expression was lower in tumor cells compared to non-tumor cells . When designing expression studies in mouse models, it is essential to account for potential isoform-specific expression patterns, as observed in the C. elegans homolog, which showed distinct localization patterns for different isoforms .

What expression systems are most effective for producing recombinant mouse Tspan14?

When producing recombinant mouse Tspan14, researchers should consider several expression systems based on the specific experimental requirements. For the extracellular domain (EC2), bacterial expression systems using E. coli can be employed to generate GST-fusion proteins, similar to the approach used for other tetraspanins . For full-length protein expression, mammalian expression systems are preferable to ensure proper post-translational modifications and folding.

The expression protocol should involve:

  • Cloning of the Tspan14 coding sequence (full-length or EC2 domain) into an appropriate expression vector

  • Transformation/transfection into the chosen expression system

  • Induction of protein expression under optimized conditions

  • Cell lysis and protein extraction using detergents suitable for membrane proteins

When expressing different isoforms (similar to TSP-14A and TSP-14B in C. elegans ), ensure that the expression constructs accurately reflect the N-terminal differences that define these isoforms. Codon optimization for the chosen expression system can significantly improve protein yields.

What are the recommended methods for detection and quantification of recombinant mouse Tspan14?

Multiple complementary approaches should be employed for detection and quantification of recombinant mouse Tspan14:

  • Flow Cytometry: This technique provides quantitative data on protein expression levels. Cells should be fixed with paraformaldehyde (4%, 10 minutes at room temperature), permeabilized with ice-cold 90% methanol (30 minutes at 4°C), and labeled with anti-Tspan14 antibodies followed by fluorescent secondary antibodies . For expression analysis, mean fluorescence intensity (MFI) should be measured using appropriate flow cytometry equipment.

  • Immunofluorescence Microscopy: For subcellular localization studies, cells can be fixed, permeabilized, and labeled similar to flow cytometry preparation. Quantification can be performed using corrected total cell fluorescence (CTCF) calculated as: CTCF = Integrated density − (Area × Mean fluorescence of background readings) .

  • Western Blot Analysis: This technique allows for verification of protein size and semi-quantitative analysis. Special attention should be paid to sample preparation for membrane proteins, often requiring non-ionic detergents like Triton X-100 or NP-40.

Data analysis should include proper controls and statistical validation across multiple biological replicates to ensure reproducibility and reliability of results.

What purification strategies yield highest purity and activity for recombinant Tspan14?

Purification of recombinant Tspan14 requires specialized approaches due to its membrane protein nature:

  • For GST-fusion proteins (EC2 domain): Affinity chromatography using glutathione-agarose beads can be employed, similar to the approach used for other tetraspanin EC2 domains . This should be followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations.

  • For full-length protein: Purification typically requires detergent solubilization followed by affinity chromatography using tags such as His6 or FLAG. For mammalian expression systems, consider using mild detergents that preserve protein folding and function.

The purified protein should be characterized by:

  • SDS-PAGE to confirm size and purity

  • Western blotting with specific antibodies

  • Mass spectrometry to verify protein identity

  • Circular dichroism to assess secondary structure integrity

For storage, protocols similar to those used for other recombinant proteins can be adapted: the protein should be stored in appropriate buffer conditions with stabilizing agents, and repeated freeze-thaw cycles should be avoided .

How is Tspan14 expression altered in cancer models, and what methodologies best capture these changes?

Research on human TSPAN14 has shown significant expression changes in cancer models. In NSCLC, TSPAN14 expression was found to be lower in tumor cells compared to non-tumor cells, and this decreased expression correlated with lower survival rates and more aggressive tumor phenotypes . To investigate similar patterns in mouse models, researchers should:

  • Use flow cytometry to quantitatively compare Tspan14 expression between normal and cancer cells, ensuring proper controls are included

  • Employ immunofluorescence microscopy to visualize expression changes and subcellular distribution alterations

  • Validate findings using multiple antibodies and detection methods to ensure specificity

Quantitative analysis should include statistical comparison of mean fluorescence intensity (MFI) between normal and cancer cells, with data normalized to appropriate housekeeping proteins or standard controls . Additionally, researchers should examine potential isoform-specific expression changes that might have distinct functional consequences, similar to the distinct roles observed for TSP-14 isoforms in C. elegans .

What functional assays effectively demonstrate Tspan14's role in disease progression?

To elucidate Tspan14's functional role in disease progression, researchers should consider multiple complementary approaches:

  • Migration and Invasion Assays: Similar to studies that demonstrated a role for TSPAN14 in metastatic potential of cancer cells , researchers can manipulate Tspan14 expression (overexpression or knockdown) and assess changes in cell migration and invasion using transwell assays.

  • Proliferation and Survival Assays: Given the correlation between decreased TSPAN14 expression and poor survival in NSCLC patients , researchers should evaluate how Tspan14 manipulation affects cell proliferation, apoptosis, and resistance to therapeutic agents.

  • In vivo Tumor Models: Orthotopic or subcutaneous implantation of Tspan14-modified cells in mouse models can provide insights into its role in tumor growth, metastasis, and response to therapy.

Data analysis should include:

  • Quantitative assessment of phenotypic changes

  • Statistical analysis across multiple biological replicates

  • Correlation with Tspan14 expression levels and isoform distribution

  • Mechanistic investigations into molecular pathways affected by Tspan14 alteration

How do the different isoforms of mouse Tspan14 contribute to its functional diversity?

Based on findings from C. elegans, where TSP-14 exists as two major isoforms (TSP-14A and TSP-14B) differing by 24 amino acids at their N-termini , mouse Tspan14 may also exhibit isoform diversity with functional implications. To investigate this:

  • Isoform Identification: Use RNA-seq and 5' RACE to identify potential Tspan14 isoforms in mouse tissues.

  • Isoform-Specific Localization: Develop isoform-specific antibodies or tagged constructs to determine subcellular localization patterns. In C. elegans, TSP-14A localizes to apical intracellular vesicles while TSP-14B localizes to the plasma membrane on the basolateral side , suggesting distinct trafficking mechanisms.

  • Functional Analysis: Use CRISPR/Cas9 to generate isoform-specific knockouts or mutations to determine their individual contributions to cellular functions.

The experimental design should include:

  • Tissue-specific expression analysis of different isoforms

  • Protein interaction studies to identify isoform-specific binding partners

  • Rescue experiments to determine functional redundancy between isoforms

What protein interaction networks are regulated by Tspan14, and how can they be systematically mapped?

Tetraspanins often function through organizing membrane microdomains and regulating protein interactions. To map Tspan14's interaction network:

  • Co-immunoprecipitation Studies: Use antibodies against Tspan14 to pull down interacting proteins, followed by mass spectrometry identification.

  • Proximity Labeling Techniques: Employ BioID or APEX2 fusion proteins to identify proteins in close proximity to Tspan14 in living cells.

  • Membrane Protein Interaction Analysis: Use chemical crosslinking or blue native PAGE to preserve and identify membrane protein complexes involving Tspan14.

Data analysis should focus on:

  • Identification of direct binding partners versus components of larger complexes

  • Comparison with interaction networks of other tetraspanins to identify unique versus shared interactions

  • Validation of key interactions using multiple complementary techniques

  • Functional significance testing through disruption of specific interactions

How does the subcellular localization of Tspan14 influence its function in different cellular contexts?

Building on observations from C. elegans TSP-14 isoforms, which show distinct subcellular localization patterns , researchers should investigate how Tspan14 localization affects its function:

  • High-Resolution Imaging: Use super-resolution microscopy techniques (STORM, PALM, or Airyscan) to precisely map Tspan14 localization within cellular compartments.

  • Trafficking Studies: Employ live-cell imaging with fluorescently tagged Tspan14 to track its movement between cellular compartments under different conditions.

  • Localization Mutants: Generate Tspan14 constructs with modified trafficking signals to alter subcellular distribution and assess functional consequences.

Experimental considerations should include:

  • Co-localization with compartment-specific markers

  • Temporal dynamics of localization during cellular processes

  • Quantitative image analysis using appropriate software tools

  • Correlation between localization patterns and functional outcomes

What controls are essential when studying recombinant mouse Tspan14 to ensure result validity?

Robust experimental design for Tspan14 research requires multiple controls:

  • Expression Controls:

    • Empty vector controls for recombinant expression studies

    • Isotype control antibodies for flow cytometry and immunofluorescence

    • Secondary antibody-only controls to assess background staining

  • Functional Controls:

    • Other tetraspanin family members (e.g., CD9, CD63) to distinguish Tspan14-specific effects from general tetraspanin functions

    • Rescue experiments with wild-type Tspan14 after knockdown or knockout

    • Concentration gradients of recombinant protein to establish dose-dependent effects

  • Technical Controls:

    • Multiple detection methods to confirm expression patterns

    • Biological replicates across different cell lines or primary cells

    • Validation with both tagged and untagged versions of the protein

Data analysis should include appropriate statistical tests and multiple comparison corrections when analyzing results across different experimental conditions.

How can functional redundancy between Tspan14 and other tetraspanins be addressed experimentally?

Tetraspanin proteins often exhibit functional redundancy, complicating the interpretation of single-gene studies. To address this challenge:

  • Comparative Expression Analysis: Map expression patterns of multiple tetraspanins across tissues and conditions to identify potential compensatory mechanisms.

  • Multi-gene Perturbation: Use combinatorial CRISPR approaches to simultaneously disrupt Tspan14 and related tetraspanins.

  • Domain Swap Experiments: Create chimeric proteins by swapping domains between Tspan14 and other tetraspanins to identify regions responsible for unique versus redundant functions.

Experimental design should include:

  • Detailed phenotypic analysis across multiple cellular functions

  • Rescue experiments with different tetraspanins

  • Computational analysis of sequence and structural similarities to predict functional overlap

What approaches can resolve contradictory findings in Tspan14 research?

As with many emerging research areas, contradictory findings about Tspan14 function may arise. To resolve such contradictions:

  • Standardization of Experimental Systems:

    • Establish consistent cell lines, culture conditions, and assay protocols

    • Define standard operating procedures for recombinant protein production and quality control

    • Create repositories of validated reagents (antibodies, expression constructs) for community use

  • Context-Dependent Analysis:

    • Systematically investigate how cellular context affects Tspan14 function

    • Consider isoform-specific effects that may explain apparently contradictory results

    • Examine how experimental conditions (2D vs. 3D culture, in vitro vs. in vivo) influence outcomes

  • Multi-omic Integration:

    • Combine transcriptomic, proteomic, and functional data to build comprehensive models of Tspan14 function

    • Use computational approaches to identify patterns and relationships not apparent in single-study analyses

When reporting results, researchers should clearly document all experimental conditions, provide complete methodological details, and acknowledge limitations of their experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.