Recombinant Mouse Tetraspanin-17 (Tspan17)

Shipped with Ice Packs
In Stock

Description

Interaction with ADAM10

Tspan17 is a member of the TspanC8 subgroup, which directly binds to ADAM10 to regulate its maturation, trafficking, and substrate specificity . Key findings:

  • ADAM10 Regulation: Tspan17 facilitates ADAM10 exit from the endoplasmic reticulum, promoting its proteolytic activity at the cell surface .

  • Substrate Specificity: Tspan17-ADAM10 complexes influence cleavage of substrates like VE-cadherin and Notch, impacting angiogenesis and cancer cell migration .

Cellular and Pathological Implications

  • Cancer: Elevated Tspan17 expression correlates with poor prognosis in glioblastoma (GBM), larger tumor size, and advanced WHO grade in humans . Knockdown reduces proliferation and invasion in glioma cells .

  • Neuroinflammation: Tspan17-ADAM10 complexes modulate leukocyte transmigration by regulating endothelial adhesion molecules .

In Vitro Studies

  • GBM Cell Lines:

    • Tspan17 siRNA reduced mRNA/protein levels by >90% in U87MG and MT-330 cells (P < 0.05) .

    • Co-transfection with miR-378a-3p antagomir and Tspan17 siRNA partially restored Tspan17 expression, mitigating apoptosis inhibition .

TreatmentTspan17 mRNA (Fold Change vs. Control)Apoptosis Rate (%)
si-Tspan170.11 ± 0.001 (U87MG)22.5 ± 1.8
miR-378a-3p antagomir5.93 ± 0.24 (U87MG)8.3 ± 0.6
Antagomir + si-Tspan172.89 ± 0.14 (U87MG)15.1 ± 1.2

Recombinant Protein Applications

  • Antibody Development: Anti-Tspan17 antibodies (e.g., ab180601) validated for WB, IHC, and IP in human and rat systems .

  • Functional Assays: Recombinant Tspan17 enables studies on ADAM10-dependent shedding mechanisms and TEM (tetraspanin-enriched microdomain) dynamics .

Knowledge Gaps and Future Directions

  • Murine-Specific Data: Limited studies directly address murine Tspan17; most insights extrapolated from rat/human homologs.

  • Therapeutic Potential: Targeting Tspan17-ADAM10 interactions could modulate Notch signaling in cancer or inflammation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any special requirements you may have. Please specify your desired format when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on your location and purchasing method. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tspan17; Fbxo23; Tm4sf17; Tetraspanin-17; Tspan-17; F-box only protein 23; Tetraspan protein SB134; Transmembrane 4 superfamily member 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tspan17
Target Protein Sequence
MPGKHQQFQDPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISALTDLGG LDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDW IRDQLNLFINNNVKAYRDDLDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRE RCGVPFSCCVRDPAEDVLNTQCGYDIRLKLELEQEGSIYTKGCVGQFEKWLQDNLIVVAG VLVGIALLQIFGLCLAQNLVSDIKAVKANW
Uniprot No.

Target Background

Function
Regulates ADAM10 maturation.
Database Links

KEGG: mmu:74257

UniGene: Mm.32883

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of mouse Tspan17 and how does it compare to other tetraspanins?

Mouse Tspan17, like other tetraspanins, is characterized by four transmembrane domains that form a short and a large extracellular loop (LEL). The LEL, also known as the EC2 domain, is particularly important as it confers specificity to individual tetraspanin members. Tspan17 belongs to the TspanC8 subgroup, which includes six members (Tspan5, 10, 14, 15, 17, and 33) that share structural similarities .

What is known about Tspan17's expression pattern in mouse tissues?

Tspan17 shows a distinct expression pattern in mouse tissues, with notable presence in neuronal cells and endothelial cells. Its expression has been linked to both normal physiological processes and pathological conditions, including neurological disorders and cancer development.

Expression analysis in multiple mouse cell types reveals that Tspan17 is not uniformly distributed, suggesting tissue-specific functions. Unlike some other tetraspanins that show ubiquitous expression, Tspan17 exhibits a more restricted pattern, which researchers should consider when designing experiments or interpreting results from different cell types .

How does mouse Tspan17 interact with ADAM10 and what functional significance does this have?

Mouse Tspan17, as a member of the TspanC8 subgroup, directly interacts with the transmembrane metalloprotease ADAM10. This interaction is critical for:

  • Facilitating ADAM10's exit from the endoplasmic reticulum

  • Promoting enzymatic maturation of ADAM10

  • Enabling proper trafficking of ADAM10 to the cell surface

  • Regulating ADAM10's substrate specificity

The Tspan17-ADAM10 interaction appears to be mediated through multiple domains, including the EC2 region of Tspan17. This association has significant functional consequences, as different TspanC8/ADAM10 complexes demonstrate distinct substrate preferences, allowing for fine-tuned regulation of proteolytic processing events. In endothelial cells, Tspan17 regulates VE-cadherin expression through its interaction with ADAM10, which subsequently promotes leukocyte transmigration .

What are the optimal methods for recombinant expression of mouse Tspan17?

Based on experimental evidence with other tetraspanins, researchers have two main approaches for recombinant expression of mouse Tspan17:

Bacterial Expression System

  • Advantages: Higher yield, cost-effective, established protocols

  • Limitations: Potential LPS contamination, challenges with proper folding, lack of post-translational modifications

  • Recommended approach: Express as GST fusion proteins focusing on the EC2 domain, which has been successful for other tetraspanins

Mammalian Expression System

  • Advantages: Better protein folding, appropriate post-translational modifications

  • Limitations: Lower yield, more expensive, technically challenging

  • Recommended approach: Despite challenges reported with other tetraspanins, mammalian expression should be attempted for functional studies requiring native conformations

What purification strategies are most effective for recombinant mouse Tspan17?

Based on experiences with other tetraspanin family members, the following purification strategy is recommended for recombinant mouse Tspan17:

  • Initial capture: For GST-fusion proteins, use glutathione sepharose affinity chromatography

  • Tag removal: Optimize thrombin cleavage conditions (consider the following parameters based on experience with other tetraspanins):

    • Incubation time: 16 hours shows better cleavage efficiency than shorter periods

    • Buffer composition: Include 500mM NaCl to enhance cleavage efficiency

    • Method selection: On-column cleavage typically yields better results than batch methods

  • Secondary purification: Following tag removal, implement size exclusion chromatography to obtain highly pure protein

  • Quality assessment: Verify protein folding using circular dichroism (CD) spectroscopy, aiming for approximately 50-52% α-helical structure similar to that observed for other tetraspanins like CD9 and CD81

Remember that purification conditions may need optimization specific to Tspan17, as slight variations in buffer conditions can significantly impact yield and purity.

How can researchers assess the functional activity of recombinant mouse Tspan17?

Assessing the functional activity of recombinant mouse Tspan17 requires multiple complementary approaches:

  • Binding studies: Evaluate direct binding to known partners (especially ADAM10) using:

    • Co-immunoprecipitation assays

    • Surface plasmon resonance (SPR)

    • Flow cytometry with fluorescently labeled protein

  • Cellular assays: Measure the impact on ADAM10-dependent processes:

    • Substrate shedding assays (e.g., VE-cadherin processing)

    • Cell migration and adhesion studies

    • Leukocyte transmigration assays

  • Competitive inhibition experiments: Compare binding between labeled and unlabeled EC2 domains to confirm specificity, as has been shown effective with other tetraspanins

  • Structural validation: Confirm proper protein folding using:

    • Circular dichroism spectroscopy

    • Thermal stability assays

    • Limited proteolysis patterns

When evaluating functional activity, it's critical to include appropriate controls, such as EC2 domains from other tetraspanins and mutated versions of Tspan17 that lack key interaction sites.

How can recombinant mouse Tspan17 be used to study ADAM10 regulation in neurological disorders?

Recombinant mouse Tspan17 provides a powerful tool for investigating ADAM10 regulation in neurological contexts through several experimental approaches:

  • Competitive disruption studies: Recombinant Tspan17 EC2 domain can be used to competitively disrupt endogenous Tspan17-ADAM10 interactions, allowing researchers to observe immediate consequences on ADAM10-mediated substrate processing relevant to neurological function .

  • Substrate specificity analysis: By comparing how different TspanC8 members (including Tspan17) alter ADAM10's substrate preference, researchers can map the specific contributions of Tspan17 to neurological substrate processing. This can be accomplished by:

    • Adding recombinant Tspan17 to neuronal cell cultures

    • Measuring changes in the processing of neurologically relevant ADAM10 substrates (e.g., amyloid precursor protein)

    • Comparing effects between wild-type and mutant Tspan17 variants

  • Protein complex reconstitution: Reconstituting Tspan17-ADAM10 complexes in artificial membrane systems allows for precise control over complex composition and can reveal how Tspan17 specifically modulates ADAM10 activity toward neurological substrates in comparison to other TspanC8 members .

  • Domain mapping: Using truncated or mutated versions of recombinant Tspan17 can help identify which domains are critical for neurological substrate selectivity, providing mechanistic insights into how Tspan17 contributes to neurological pathologies .

What signaling pathways are modulated by Tspan17 and how can recombinant protein be used to study them?

Tspan17, like other tetraspanins, influences multiple signaling pathways through its scaffolding functions. Recombinant Tspan17 can be utilized to investigate these pathways through the following approaches:

  • GTPase regulation: Tetraspanins have been shown to modulate small GTPase activity, particularly RhoA and Rac1. Researchers can:

    • Treat cells with recombinant Tspan17 EC2 domains

    • Measure changes in GTPase activation using pull-down assays or FRET biosensors

    • Compare with other tetraspanins (CD9, CD151) known to affect RhoA/Rac1 balance

  • Membrane protein organization: Tspan17 contributes to tetraspanin-enriched microdomains (TEMs) that compartmentalize signaling molecules. Researchers can:

    • Use fluorescently labeled recombinant Tspan17 to track TEM formation

    • Analyze how Tspan17 redistributes signaling molecules within the membrane

    • Investigate consequences for downstream signaling events

  • ADAM10-dependent signaling: As Tspan17 regulates ADAM10, it indirectly influences numerous signaling pathways affected by ADAM10 substrates. Researchers can:

    • Apply recombinant Tspan17 to modulate ADAM10 activity

    • Monitor changes in substrate shedding (e.g., growth factors, cytokines)

    • Observe alterations in downstream signaling cascades

Table 1: Signaling Pathways Potentially Modulated by Tspan17 Based on Tetraspanin Family Studies

Signaling PathwayMechanism of Tspan17 InfluenceExperimental Approach with Recombinant Protein
RhoA/Rac1 GTPasesScaffold for GTPase regulatorsGTPase pull-down assays after recombinant protein treatment
ADAM10-mediated sheddingDirect regulation of ADAM10 activitySubstrate shedding assays with/without recombinant Tspan17
Integrin signalingOrganization of integrin-containing TEMsAdhesion/spreading assays with recombinant EC2 domains
Cytoskeletal organizationIndirect via GTPase regulationImaging of cytoskeletal changes after EC2 treatment
FcεRI-mediated signalingPotential modulation of receptor organizationDegranulation assays in mast cells/basophils

How does mouse Tspan17 differ functionally from human Tspan17, and what implications does this have for translational research?

While the search results don't directly address species-specific differences between mouse and human Tspan17, comparative analysis can be approached through several research strategies:

  • Sequence homology analysis: Perform detailed sequence comparisons of mouse versus human Tspan17, with particular attention to:

    • Conservation of key functional domains, especially the EC2 region

    • Species-specific post-translational modification sites

    • Variations in protein interaction motifs

  • Cross-species functional studies: Use recombinant mouse and human Tspan17 proteins to:

    • Compare binding affinities to ADAM10 from both species

    • Evaluate substrate specificity differences

    • Assess species-specific protein complex formation

  • Cellular context experiments: Test both mouse and human recombinant Tspan17 in:

    • Mouse cell lines

    • Human cell lines

    • Compare functional outcomes to identify species-specific effects

When transitioning from mouse models to human applications, researchers should carefully validate any findings with human Tspan17 to ensure translational relevance.

Why might recombinant mouse Tspan17 show limited functional activity in cellular assays?

Several factors can contribute to limited functional activity of recombinant mouse Tspan17 in cellular assays:

  • Protein folding issues: Bacterial expression systems may not produce properly folded Tspan17, particularly in the EC2 domain. Circular dichroism spectroscopy should be used to verify α-helical content (expecting approximately 50-52% based on other tetraspanins) .

  • LPS contamination: Bacterially expressed recombinant proteins often contain lipopolysaccharide (LPS), which can confound cellular assays by triggering inflammatory responses. Rigorous endotoxin removal and testing are essential, as LPS effects may be mistakenly attributed to the recombinant protein .

  • Tag interference: Even after GST tag removal, residual amino acids or conformational changes may persist. Consider testing multiple constructs with different tag placements or tag-free expression systems .

  • Lack of post-translational modifications: Mouse Tspan17 likely requires palmitoylation for proper function, similar to other tetraspanins. Bacterial expression systems cannot provide this modification, potentially compromising activity .

  • Insufficient protein concentration: Some tetraspanin effects are only observable at higher concentrations (1.5μM or above), as shown in studies with other family members .

  • Experimental timing: Pre-incubation duration matters; studies with other tetraspanins demonstrate different effects with 1-hour versus 16-hour pre-incubations .

To troubleshoot, systematically address these issues through improved purification protocols, endotoxin removal, higher protein concentrations, and alternative expression systems.

What controls are essential when working with recombinant mouse Tspan17?

When designing experiments with recombinant mouse Tspan17, the following controls are essential:

  • Expression tag control: Include the purified tag alone (e.g., GST) to distinguish between effects caused by the tag versus Tspan17 .

  • Related tetraspanin controls: Include recombinant EC2 domains from other tetraspanins (e.g., CD9, CD81, CD63, CD151) to distinguish Tspan17-specific effects from general tetraspanin effects .

  • Heat-denatured Tspan17: Include heat-inactivated protein to confirm that observed effects require properly folded protein.

  • LPS control: Include equivalent amounts of LPS to match any residual endotoxin in your preparation, ensuring effects aren't due to contamination .

  • Species-relevance control: When using mouse Tspan17 on human cells (or vice versa), include species-matched recombinant protein to control for species-specific interactions.

  • Concentration gradient: Test multiple concentrations of recombinant Tspan17, as some cellular effects may only be observable at specific concentration ranges .

  • Timing controls: Include multiple pre-incubation times, as effects may vary between short-term (1 hour) and long-term (16 hour) exposures .

These controls will help distinguish genuine Tspan17-mediated effects from experimental artifacts and provide context for interpreting your results.

How can researchers address potential endotoxin contamination in recombinant mouse Tspan17 preparations?

Endotoxin contamination is a significant concern when working with bacterially expressed recombinant proteins like mouse Tspan17. Based on experiences with other tetraspanins, researchers should implement the following strategy:

  • Endotoxin removal methods:

    • Triton X-114 phase separation

    • Polymyxin B affinity chromatography

    • Endotoxin removal resins (commercially available)

    • Multiple rounds of purification may be necessary

  • Endotoxin testing:

    • Quantify endotoxin levels using Limulus Amebocyte Lysate (LAL) assays

    • Document endotoxin content in international units per mg of protein

    • Ensure levels are below 0.1 EU/μg for cellular assays

  • Experimental controls:

    • Include pure LPS at equivalent levels to your recombinant protein preparation

    • Verify that LPS alone doesn't reproduce the effects of your recombinant protein

    • Consider using LPS-binding agents in assays where complete removal is impossible

  • Correlation analysis:

    • Plot biological effects against endotoxin content across different preparations

    • Confirm that observed effects don't correlate with endotoxin levels

    • This approach has been successfully used with other tetraspanins to demonstrate that effects were not due to LPS contamination

Remember that some cell types (like macrophages) are particularly sensitive to endotoxin, so even low levels may confound results in these systems.

How might recombinant mouse Tspan17 be utilized to develop therapeutic strategies for diseases involving ADAM10 dysregulation?

Recombinant mouse Tspan17 offers several promising avenues for therapeutic development targeting ADAM10-related pathologies:

  • Selective ADAM10 modulation: Since different TspanC8 members (including Tspan17) direct ADAM10 toward specific substrates, recombinant Tspan17 or its derivatives could be used to selectively enhance or inhibit the processing of disease-relevant substrates without affecting other ADAM10 functions .

  • Diagnostic biomarker development: Recombinant Tspan17 can be used to develop assays that detect abnormal Tspan17-ADAM10 complexes or substrate processing patterns, serving as diagnostic tools for conditions involving ADAM10 dysregulation .

  • Structure-based drug design: Detailed structural analysis of the Tspan17-ADAM10 interaction interface, facilitated by purified recombinant proteins, can guide the development of small molecules that selectively modulate this specific interaction .

  • Targeting neurological disorders: Given the links between tetraspanins and neurological conditions, recombinant Tspan17 could be particularly valuable for developing therapeutics for neurodegenerative diseases where ADAM10 processing of neuronal substrates is dysregulated .

  • Cancer therapeutics: As research links Tspan17 to cancer processes, recombinant protein could be used to develop strategies that interrupt aberrant signaling in malignant cells, particularly focusing on ADAM10-mediated release of growth factors and cytokines .

Future research should focus on: (1) identifying the specific substrates most affected by Tspan17-ADAM10 interactions, (2) developing high-throughput screening methods using recombinant proteins to identify modulators, and (3) creating delivery systems for targeted intervention in affected tissues.

What emerging technologies could enhance the study of recombinant mouse Tspan17 interactions and functions?

Several cutting-edge technologies hold promise for advancing Tspan17 research:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize TEMs containing Tspan17

    • Single-molecule tracking to analyze the dynamics of Tspan17-ADAM10 interactions

    • FRET biosensors to monitor Tspan17's impact on signaling events in real-time

  • Membrane protein structural biology:

    • Cryo-electron microscopy to determine the structure of Tspan17-ADAM10 complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Molecular dynamics simulations to understand conformational changes

  • Genetic and genomic approaches:

    • CRISPR-Cas9 gene editing to create precise mutations in Tspan17

    • Single-cell transcriptomics to identify cell-specific effects of Tspan17 modulation

    • Proteomics to comprehensively identify the Tspan17 interactome

  • Advanced reconstitution systems:

    • Nanodiscs incorporating recombinant Tspan17 for controlled biochemical studies

    • Microfluidics platforms to study membrane dynamics with reconstituted Tspan17

    • Synthetic biology approaches to engineer novel Tspan17 variants with enhanced or modified functions

  • Therapeutic delivery platforms:

    • Nanoparticle delivery of recombinant Tspan17 or mimetic peptides

    • Exosome engineering to deliver functional Tspan17 to target tissues

    • Cell-penetrating peptides derived from key Tspan17 interaction domains

These technologies will help overcome current limitations in understanding the precise mechanisms by which Tspan17 regulates ADAM10 and influences cellular signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.