Recombinant Mouse Tetraspanin-33 (Tspan33)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
Tspan33; Pen; Tetraspanin-33; Tspan-33; Penumbra; mPen; Proerythroblast new membrane
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tspan33
Target Protein Sequence
MARRPGVPAAYGDEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACL AVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTIVFLLQLAAGILGFVFSD KARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYRDWSQNMYFNCSEDNPSR ERCSVPYSCCLPTPNQAVINTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLG GVALGLAIPQLVGILLSQVLVNQIKDQIKLQLYNQQHRADPWY
Uniprot No.

Target Background

Function

Tetraspanin-33 (TSPAN33) plays a crucial role in normal erythropoiesis, influencing the differentiation of erythroid progenitors. It regulates the maturation and trafficking of the transmembrane metalloprotease ADAM10, and negatively regulates ligand-induced Notch activity, likely by modulating ADAM10 activity. Furthermore, TSPAN33 mediates the docking of ADAM10 to zonula adherens through interactions with ADAM10 and, in a PDZD11-dependent manner, with the zonula adherens protein PLEKHA7.

Gene References Into Functions
  1. Research suggests TSPAN33 is a novel regulatory element in macrophage inflammation, representing a potential therapeutic target. PMID: 27574297
  2. TSPAN33 (Penumbra) exhibits a positive role in erythropoiesis; its deletion or mutation can lead to anemia. PMID: 17158226
Database Links

KEGG: mmu:232670

UniGene: Mm.225289

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, adherens junction. Cytoplasm.
Tissue Specificity
Predominantly expressed in erythroblasts.

Q&A

What is Tetraspanin-33 and what distinguishes it from other B cell markers?

TSPAN33 is a homodimeric disulfide-linked member of the tetraspanin family that functions as a regulatory element in various B cell processes. Unlike common B cell markers such as CD19 and CD20 that are expressed on both resting and activated B cells, TSPAN33 is specifically and strongly expressed by activated B lymphocytes only . It plays critical roles in cytoskeleton and plasma membrane-related phenomena, including protrusion formation, adhesion, phagocytosis, and cell motility . In mice, Tspan33 was initially identified in erythroblasts (TER 119+ fraction of bone marrow cells), but more recent research has confirmed its expression in activated murine B cells .

How should researchers detect Tspan33 expression in mouse samples?

Detection of Tspan33 requires careful consideration of methodology based on your experimental needs:

  • Transcript Level Detection: Quantitative RT-PCR represents the most reliable method for detecting Tspan33 mRNA expression in mouse tissues. Use standard RNA isolation protocols (such as Qiagen RNeasy kit) followed by reverse transcription and qPCR with specific probes designed to detect Tspan33 .

  • Protein Level Detection: Western blotting using polyclonal antibodies against Tspan33 can successfully detect protein expression. For immunohistochemistry applications, epitope retrieval methods (using protease and/or heat treatment) are essential for proper antigen detection .

  • Flow Cytometry Considerations: While human TSPAN33 can be detected using PE-conjugated monoclonal antibodies by flow cytometry, researchers working with mouse samples should validate antibody specificity, as some commercial anti-Tspan33 antibodies may not work efficiently for FACS analysis of mouse samples .

What expression pattern does Tspan33 exhibit in normal mouse tissues?

Tspan33 shows a highly specific expression pattern in mice:

  • Activated B Cells: Significantly upregulated (approximately 4-fold increase) following LPS + IL-4 stimulation compared to resting conditions .

  • Bone Marrow: Expressed in the TER 119+ fraction (erythroblasts) but not in neutrophils, T cells, monocytes, NK cells, or resting B cells .

  • Splenic B Cells: Low basal expression that increases dramatically (>50-fold) upon stimulation with LPS + IL-4 in a dose-dependent manner .

  • Other Tissues: Generally low or undetectable expression in most other tissues and cell types (including T cells), confirming its specificity as a B cell activation marker .

How does mouse Tspan33 compare to human TSPAN33?

Despite some functional similarities, researchers should note these important comparisons:

  • Sequence Homology: Full-length human TSPAN33 shares 96% amino acid identity with mouse TSPAN33, suggesting high conservation of function between species .

  • Expression Patterns: While mouse Tspan33 was initially characterized in erythroid progenitors, human TSPAN33 shows very low expression in bone marrow and is instead strongly expressed in activated B lymphocytes .

  • Model Relevance: The high homology makes mouse models valuable for studying human TSPAN33 functions, but researchers should account for tissue-specific expression differences when translating findings between species .

What methods are most effective for studying Tspan33 function in mouse B cell activation?

For investigating Tspan33's role in B cell activation, researchers should consider these methodological approaches:

  • In vitro B Cell Stimulation Models:

    • Isolate splenic B cells using Ficoll density gradient separation with CD3/CD11c panning for enrichment

    • Stimulate with LPS (10 ng/mL) + IL-4 for consistent Tspan33 upregulation

    • Alternative stimulation protocols using anti-CD40 + IL-4 or anti-IgD + IL-4 also effectively induce Tspan33 expression

  • Cell Line Models:

    • The murine B cell line A20-2J shows dose-dependent increases in Tspan33 expression when stimulated with LPS + IL-4 and serves as a reliable model for mechanistic studies

    • For comparative studies, Baf3 cells (Pro-B cell line) can serve as a negative control as they do not express Tspan33

  • Overexpression and Knockdown Approaches:

    • Generating stable Tspan33 overexpression models in appropriate B cell lines allows for studying gain-of-function phenotypes

    • Tspan33 knockdown cells display opposite phenotypes to overexpression models, providing complementary loss-of-function data

How does Tspan33 influence B lymphocyte mechanical properties and membrane dynamics?

Tspan33 serves as a critical regulator of B cell plasma membrane properties through several mechanisms:

  • Membrane Tension Regulation:

    • Tspan33 expression inhibits changes in roughness and membrane tension during fibronectin-induced spreading

    • This effect appears to modify cytoskeleton-membrane interactions that are essential for B cell function

  • Subcellular Distribution:

    • Tspan33 localizes to specific subcellular compartments including membrane microvilli, the Golgi apparatus, and extracellular vesicles

    • This distribution pattern suggests involvement in membrane organization and trafficking processes

  • Functional Consequences:

    • Cells with Tspan33 overexpression show diminished phagocytic ability and altered adhesion properties due to aberrant expression of integrins

    • These cells simultaneously present enhanced migratory phenotypes with augmented chemotaxis and invasion rates

    • The seemingly contradictory effects on adhesion versus migration highlight Tspan33's complex role in regulating membrane dynamics and cellular behavior

What phenotypic changes are observed in Tspan33 knockout mouse models?

Researchers investigating Tspan33-/- mouse models have observed several important phenotypic changes:

  • Hematopoietic Effects:

    • Some Tspan33-/- mice display abnormal erythropoiesis within 3 months of age

    • Splenomegaly develops in these mice at approximately 1 year of age

  • B Cell Function Considerations:

    • Given Tspan33's role in B cell activation, researchers should thoroughly examine B cell development, activation potential, and antibody responses in knockout models

    • Particular attention should be paid to processes requiring membrane remodeling such as phagocytosis, migration, and adhesion

  • Experimental Design Notes:

    • When working with Tspan33 knockout models, researchers should account for potential compensatory mechanisms from other tetraspanin family members

    • Age-dependent phenotypes suggest that longitudinal studies are important for fully characterizing the effects of Tspan33 deficiency

How can researchers leverage Tspan33 in studies of B cell malignancies and autoimmune diseases?

Tspan33's specific expression pattern makes it valuable for studying pathological B cell conditions:

  • B Cell Lymphoma Research:

    • Tspan33 is highly expressed in Hodgkin's Lymphoma (particularly in Reed-Sternberg cells) and Diffuse Large B Cell Lymphoma (DLBCL)

    • It is notably absent in Mantle Cell Lymphoma, providing a potential diagnostic differentiator

    • Burkitt's lymphoma cell lines (Raji, Ramos, and Daudi) all express Tspan33 at both mRNA and protein levels

  • Autoimmune Disease Applications:

    • Tspan33 expression has been detected in systemic lupus erythematosus (SLE) and rheumatoid arthritis (RA), conditions where B cells contribute to pathology

    • This suggests potential utility as a biomarker or therapeutic target in B cell-mediated autoimmune conditions

  • Methodological Approaches:

    • Immunohistochemistry on tissue arrays represents an effective technique for studying Tspan33 in patient samples

    • When working with lymphoma tissues, epitope retrieval methods are essential for accurate Tspan33 detection

    • Flow cytometry using specific anti-Tspan33 antibodies can help quantify Tspan33+ B cells in blood or tissue samples from disease models

What are the optimal conditions for studying Tspan33-mediated effects on B cell migration?

When investigating Tspan33's influence on B cell migration, researchers should consider these methodological approaches:

  • Chemotaxis Assays:

    • Use transwell migration assays with appropriate chemoattractants (CXCL12/CXCL13) to assess directed migration

    • Compare Tspan33-overexpressing cells with knockdown models to establish causality in migration phenotypes

    • Include time-course measurements to capture both early and late migration responses

  • Invasion Assays:

    • Matrigel-coated transwell chambers provide a useful model for studying B cell invasion capacity

    • Tspan33-overexpressing cells demonstrate enhanced invasion rates, offering a reliable readout for functional studies

  • Live Cell Imaging:

    • Time-lapse microscopy of Tspan33-expressing cells allows visualization of dynamic membrane changes during migration

    • Quantify parameters such as migration velocity, directionality, and morphological changes during movement

  • Substrate Considerations:

    • Include fibronectin-coated surfaces to study Tspan33's effects on integrin-mediated adhesion and migration

    • The inhibitory effect of Tspan33 on fibronectin-induced spreading represents a key functional readout

How should researchers interpret contradictory data when studying Tspan33 function?

When faced with seemingly contradictory results in Tspan33 research, consider these analytical approaches:

  • Adhesion vs. Migration Paradox:

    • Tspan33 appears to simultaneously reduce cell adhesion properties while enhancing migratory phenotypes

    • This apparent contradiction can be resolved by recognizing that efficient migration requires precisely balanced adhesion - strong enough for traction but weak enough to allow detachment

    • Analyze both processes in the same experimental system to determine how Tspan33 achieves this balance

  • Expression Pattern Discrepancies:

    • Early studies identified Tspan33 in mouse erythroid progenitors, while later work emphasized B cell expression

    • These differences may reflect true biological variation in expression patterns between tissues, developmental stages, or species

    • Use multiple detection methods (qPCR, western blot, IHC) to comprehensively map expression across tissues

  • Functional Heterogeneity:

    • Different experimental systems may reveal varied or even opposing Tspan33 functions

    • Consider the specific cellular context, activation state, and experimental conditions when interpreting results

    • When possible, validate key findings across multiple cell types or model systems

What technical challenges might researchers encounter when working with recombinant mouse Tspan33?

Several technical considerations deserve attention when working with recombinant mouse Tspan33:

What are promising applications for Tspan33 in therapeutic development?

Emerging research suggests several promising therapeutic applications for Tspan33:

  • B Cell Malignancy Treatment:

    • Tspan33's specific expression in various B cell lymphomas, including Hodgkin's Lymphoma and DLBCL, positions it as a potential therapeutic target

    • Development of Tspan33-targeted antibodies or chimeric antigen receptor (CAR) T cells could provide selective approaches for treating these malignancies

    • The absence of Tspan33 in resting B cells could potentially allow for elimination of malignant cells while sparing normal B cell populations

  • Autoimmune Disease Intervention:

    • Tspan33's expression in B cells contributing to autoimmune pathologies like SLE and RA suggests potential therapeutic relevance

    • Targeting Tspan33 might offer a more selective approach compared to current B cell-depleting therapies

    • Researchers should explore whether blocking Tspan33 function can modulate abnormal B cell activation in autoimmune contexts

  • Biomarker Development:

    • Tspan33's restricted expression pattern makes it valuable as a diagnostic or prognostic biomarker

    • Future studies should correlate Tspan33 expression levels with clinical outcomes in B cell malignancies and autoimmune diseases

    • Development of sensitive detection methods for clinical applications represents an important research direction

How might Tspan33 interact with other tetraspanin family members in regulating B cell functions?

Understanding Tspan33's relationships with other tetraspanins presents an important research frontier:

  • Tetraspanin Web Interactions:

    • Tetraspanins typically function within "tetraspanin-enriched microdomains" (TEMs) where multiple family members interact

    • Research should investigate whether Tspan33 forms complexes with other tetraspanins in B cells

    • Techniques such as co-immunoprecipitation, proximity ligation assays, and super-resolution microscopy can help map these interactions

  • Functional Redundancy and Compensation:

    • When studying Tspan33 knockout models, researchers should assess whether other tetraspanins show compensatory upregulation

    • The potential functional overlap between Tspan33 and related family members may explain partial phenotypes in knockout studies

  • Signaling Pathway Integration:

    • Future research should elucidate how Tspan33 interacts with key B cell signaling pathways

    • Particular focus should be placed on pathways related to cytoskeletal reorganization, membrane dynamics, and B cell activation

What are the key considerations for researchers beginning work with mouse Tspan33?

For researchers initiating studies with mouse Tspan33, these practical recommendations may prove valuable:

  • Expression Analysis Approach:

    • Begin with qRT-PCR to establish baseline Tspan33 expression in your experimental system

    • Validate protein expression using western blotting with specific antibodies

    • For tissue localization studies, optimize immunohistochemistry protocols with appropriate epitope retrieval methods

  • Functional Study Design:

    • Focus initial investigations on B cell activation, migration, and adhesion phenotypes

    • Include both gain-of-function (overexpression) and loss-of-function (knockdown) approaches to establish causality

    • Consider the context-dependent nature of Tspan33 functions in different cell types and activation states

  • Collaborative Opportunities:

    • The intersection of Tspan33 with both normal B cell biology and pathological conditions offers rich collaborative potential

    • Partner with clinical researchers to access patient samples for translational studies

    • Combine expertise in membrane biology, immunology, and oncology for comprehensive investigation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.