Recombinant Mouse Tetraspanin-6 (Tspan6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Tetraspanin-6 (Tspan6)

Recombinant Mouse Tetraspanin-6 (Tspan6) is a bioengineered version of the transmembrane protein encoded by the Tspan6 gene. This protein belongs to the tetraspanin family, characterized by four conserved transmembrane domains and roles in cellular signaling, adhesion, and vesicle trafficking . Recombinant Tspan6 is produced via heterologous expression systems, primarily in E. coli or mammalian cells, and is used extensively in research to study its biological functions, including its role in Alzheimer’s disease, colorectal cancer, synaptic plasticity, and innate immunity .

Biological Functions of Tspan6

Tspan6 regulates diverse cellular processes, as demonstrated by studies on its recombinant and endogenous forms:

Alzheimer’s Disease Pathology

Tspan6 modulates amyloid-β (Aβ) production by affecting APP metabolism:

  • Autophagy-Lysosome Dysfunction: Overexpression of Tspan6 slows autophagosome-lysosome fusion, impairing degradation of APP-C-terminal fragments (APP-CTFs) and increasing Aβ accumulation .

  • Exosome Secretion: Tspan6 recruits syntenin-1, enhancing exosome secretion of APP-CTFs, a mechanism linked to Aβ spread in Alzheimer’s disease .

Colorectal Cancer (CRC)

Tspan6 acts as a tumor suppressor:

  • EGFR Signaling Inhibition: Deletion of Tspan6 activates EGFR-dependent pathways, promoting tumor growth and metastasis. Patients with low Tspan6 expression show poor survival and reduced responsiveness to EGFR-targeted therapies (e.g., Cetuximab) .

  • TGF-α Regulation: Tspan6 forms a complex with TGF-α and syntenin-1, suppressing TGF-α secretion and limiting CRC progression .

Synaptic Plasticity and Cognition

  • Enhanced Basal Transmission: Tspan6 knockout mice exhibit increased synaptic transmission but impaired long-term potentiation (LTP), suggesting a role in postsynaptic regulation .

  • Homology to Tspan7: Tspan6 shares 59% identity with Tspan7, which regulates AMPA receptor trafficking and synaptic development .

Innate Immunity

Tspan6 negatively regulates retinoic acid-inducible gene I-like receptor (RLR) signaling:

  • MAVS Interaction: Tspan6 inhibits the formation of the MAVS signalosome, reducing interferon-β (IFN-β) production. Ubiquitination of Tspan6 at lysine residues (K11, K16, K43) enhances this inhibition .

Research Applications of Recombinant Tspan6

Recombinant Tspan6 is utilized in:

ApplicationMethodOutcome
Alzheimer’s Disease ModelsCo-expression with APP in vitroAnalysis of Aβ production and exosome cargo
Cancer TherapeuticsKnockdown/overexpression in CRC cellsEvaluation of EGFR inhibitor efficacy
Synaptic Function StudiesHippocampal field recordings in Tspan6 KO miceAssessment of LTP deficits
Immune Response ProfilingMAVS co-expression in 293T cellsMeasurement of IFN-β suppression

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
Tspan6; Tm4sf6; Tetraspanin-6; Tspan-6; Transmembrane 4 superfamily member 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Tspan6
Target Protein Sequence
MASPSRRLQTKPVITCLKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIGTGTVIILLGTFGCFATCRTSAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKN SFKSNYENALKEYNSTGDYRSEAVDKIQSTLHCCGVTNYGDWKGTNYYSETGFPKSCCKL EGCYPQRDADKVNEEGCFIKVMTTIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV
Uniprot No.

Target Background

Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is Tspan6 expressed in normal mouse tissues, particularly in the brain?

Tspan6 is widely expressed in various normal epithelial tissues . In the brain, Tspan6 RNA has been detected specifically in the pyramidal layer of the hippocampus and granule cells of the dentate gyrus . This expression pattern was confirmed using RNA scope technology, which revealed Tspan6 RNA molecules (visualized as white dots) throughout these regions, while synaptophysin RNA (stained in red) served as a synaptic marker .

Expression analysis through real-time semi-quantitative PCR shows consistent expression in wild-type mice, which is completely absent in Tspan6 knockout models when using primers designed between exon 1 and 3 . Interestingly, when primers downstream of the neomycin cassette insertion (in exon 4 and 5) are used, reduced expression (approximately 35% of wild-type levels) is still detected in knockout mice, suggesting partial RNA degradation rather than complete elimination .

How are Tspan6 knockout mouse models generated, and what validation methods should be used?

The Tspan6 knockout (KO) mouse model has been generated through the insertion of a neomycin cassette into exon 2 of the Tspan6 gene . This insertion disrupts the normal transcription and translation of the gene, resulting in functional knockout.

Generation method:

  • ES cells derived from the 129/OlaHsd mouse sub-strain were used to generate chimeric mice

  • F1 mice were generated by breeding with C57BL/6 females

  • F2 homozygous mutant mice were produced by intercrossing F1 heterozygous males and females

  • The KO line was subsequently backcrossed several times to C57BL/6

Validation methods:

  • Genotyping: PCR amplification using three different primers targeting regions around the insertion. Primers should be designed to identify both wild-type and knockout alleles .

  • RNA expression analysis: Real-time semi-quantitative PCR using:

    • Primers between exon 1 and 3 (WT-specific primers)

    • Primers in exon 4 and exon 5 (downstream of insertion)

    • Normalization against housekeeping genes (Actin and GAPDH)

  • Protein expression validation: Western blotting of neuronal lysates from cortical primary cultures showing absence of Tspan6 protein in KO conditions

  • RNA scope analysis: A multiplex fluorescent assay can be used to visualize Tspan6 RNA expression in brain tissue sections, confirming absence in KO animals

What are the optimal storage and handling conditions for recombinant mouse Tspan6 protein?

Based on manufacturer recommendations for recombinant mouse Tspan6 protein :

Storage conditions:

  • Store lyophilized protein at -20°C/-80°C

  • For extended storage, maintain at -20°C or -80°C

  • Shelf life of lyophilized form is typically 12 months at -20°C/-80°C

  • For liquid form, shelf life is approximately 6 months at -20°C/-80°C

Handling recommendations:

  • Avoid repeated freeze-thaw cycles as this can compromise protein integrity

  • Store working aliquots at 4°C for up to one week

  • For reconstitution:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • Aliquot to minimize freeze-thaw cycles

How does Tspan6 influence synaptic transmission and plasticity in the hippocampus?

Tspan6 plays a key role in regulating hippocampal synaptic transmission and long-term potentiation (LTP). Research using Tspan6 knockout mouse models has revealed several important findings:

Electrophysiological changes:

  • Hippocampal field recordings from Tspan6 KO mice show enhanced basal synaptic transmission compared to wild-type controls

  • Input-output relations between stimulus intensity applied to Schaffer collateral fibers and the slope of field excitatory postsynaptic potentials (fEPSP) are significantly altered in Tspan6 KO mice (F(11,583) = 9.447, p < 0.0001, repeated measurements ANOVA)

  • Long-term potentiation (LTP) is impaired in Tspan6 KO mice following theta-burst stimulation (5 trains, each with 10 bursts at 5 Hz, each burst containing 4 pulses at 100 Hz)

  • Paired-pulse facilitation ratios at different interstimulus intervals (50, 100, 200, and 400ms) remain normal, suggesting that Tspan6 affects postsynaptic rather than presynaptic terminals

Molecular mechanisms:
Despite these electrophysiological changes, no significant alterations in spine morphology or postsynaptic markers were detected in Tspan6 KO mice compared to wild types . Similarly, surface expression of GluA1 was not increased in Tspan6 KO hippocampal primary neurons , suggesting complex regulatory mechanisms beyond direct receptor trafficking.

Interestingly, Tspan6 is highly homologous to Tspan7 (59% amino acid identity), which has been previously associated with X-linked intellectual disability and shown to interact with PICK1 in the PSD complex, regulating AMPA receptor trafficking and hippocampal spine development .

What role does Tspan6 play in cancer biology, particularly in relation to EGFR signaling?

Tspan6 functions as a tumor suppressor in multiple cancer types through regulation of EGFR signaling pathways:

Colorectal cancer (CRC):

  • Tspan6 negatively regulates EGFR-dependent signaling pathways

  • It forms a tripartite complex with transmembrane form of TGF-α (tmTGF-α) and the adaptor protein syntenin-1

  • This complex inhibits secretion of TGF-α, thereby attenuating EGFR activation

  • Tspan6 expression is frequently decreased or lost in CRC, correlating with poor patient survival

  • Higher Tspan6 expression correlates with better patient responses to EGFR-targeted therapies (e.g., Cetuximab)

Ras-driven cancer:

  • Tspan6 acts as a suppressor of Ras-driven cancer, including pancreatic and lung tumors

  • Whole-body knockout and tumor cell-specific inactivation of Tspan6 in mice enhances Kras-driven lung tumor initiation and malignant progression

  • Mechanistically, TSPAN6 binds directly to EGFR and blocks EGFR-induced RAS activation

  • Inactivation of TSPAN6 induces epithelial-to-mesenchymal transition and inhibits cell migration in vitro and in vivo

  • Low TSPAN6 expression correlates with poor prognosis in patients with lung and pancreatic cancers with mesenchymal morphology

How can researchers properly design experiments to study Tspan6's role in regulating EGFR signaling using mouse models?

When investigating Tspan6's role in regulating EGFR signaling using mouse models, researchers should consider these experimental design elements:

Mouse model selection:

  • Tspan6 knockout vs. conditional knockout:

    • Constitutive Tspan6 KO models are suitable for initial studies

    • For tissue-specific effects, consider floxed Tspan6 alleles that can be inactivated in specific cell types with appropriate Cre-drivers

  • Cancer model integration:

    • Combine with APCmin/+ mice for colorectal cancer studies

    • For lung cancer studies, combine with Kras-driven models

    • For mechanistic studies, consider xenograft models using human cancer cell lines with manipulated Tspan6 expression

Experimental approaches:

  • Ex vivo organoid cultures:

    • Intestinal organoids derived from Tspan6 KO mice with/without APC mutation

    • Assess growth with/without EGF and response to EGFR inhibitors (e.g., lapatinib)

    • Monitor activation of EGFR and downstream pathways (pERK1/2) via Western blotting and immunohistochemistry

  • Signaling pathway analysis:

    • Investigate EGFR activation in response to different ligands

    • Use phospho-specific antibodies to detect activation of EGFR (pY1068) and downstream effectors

    • Consider co-immunoprecipitation to detect Tspan6 interaction with EGFR

  • In vivo tumor growth and response to therapy:

    • Monitor tumor incidence, growth rate, and metastatic potential

    • Assess response to EGFR-targeted therapies (e.g., Cetuximab, Erlotinib)

    • Consider molecular imaging approaches to track EGFR activation in vivo

Complementary in vitro studies:

  • Transfection of Tspan6 into cell lines (gain-of-function)

  • siRNA or CRISPR-based knockdown/knockout (loss-of-function)

  • Co-culture systems to study paracrine effects of Tspan6-regulated growth factor secretion

How does Tspan6 interact with other tetraspanin family members, and what methodological approaches can be used to study these interactions?

Tetraspanins are known to form tetraspanin-enriched microdomains (TEMs) through homo- and hetero-oligomerization. While specific interactions between Tspan6 and other tetraspanins aren't extensively documented in the provided search results, several methodological approaches can be employed to study these potential interactions:

Methodological approaches:

  • Proximity-based protein interaction assays:

    • Proximity Ligation Assay (PLA) to detect close proximity between Tspan6 and other tetraspanins in cells

    • FRET or BRET to measure direct protein-protein interactions in living cells

    • BioID or APEX2 proximity labeling to identify proteins in close proximity to Tspan6

  • Co-immunoprecipitation and pull-down assays:

    • Use recombinant His-tagged Tspan6 protein for pull-down experiments

    • Perform co-IP using antibodies against Tspan6 and other tetraspanins (e.g., CD81 )

    • Consider mild detergent conditions (CHAPS, Brij-97) that preserve tetraspanin-tetraspanin interactions

  • Membrane protein complex isolation:

    • Sucrose gradient centrifugation to isolate membrane microdomains

    • Blue native PAGE to preserve native protein complexes

    • Chemical crosslinking before solubilization to stabilize transient interactions

  • Advanced microscopy techniques:

    • Super-resolution microscopy (STORM, PALM) to visualize tetraspanin microdomains

    • Single-particle tracking to monitor dynamics of tetraspanin interactions

    • Fluorescence correlation spectroscopy to measure co-diffusion

Research questions to address:

  • Does Tspan6 interact with Tspan7, given their high homology (59% amino acid identity) ?

  • How do Tspan6 interactions with common tetraspanin partners (CD9, CD63, CD81) differ from other family members?

  • Are Tspan6-containing TEMs distinct from other tetraspanin-enriched microdomains?

  • How do Tspan6 interactions with other tetraspanins influence its roles in EGFR signaling regulation?

What explains the differential effects of Tspan6 knockout on learning and memory despite altered synaptic transmission?

An intriguing finding from studies of Tspan6 knockout mice is that despite showing enhanced basal synaptic transmission and impaired long-term potentiation (LTP), these mice display normal performance in hippocampus-dependent memory tests . This apparent contradiction warrants deeper investigation.

Observed contradictory phenotype:

  • Electrophysiological changes:

    • Enhanced basal synaptic transmission

    • Impaired long-term potentiation (LTP)

    • Normal paired-pulse facilitation

  • Behavioral outcomes:

    • Normal locomotor behavior

    • No defects in hippocampus-dependent memory tests assessed by Morris water maze

    • Normal spatial learning (equivalent time to find platform during acquisition)

    • Normal spatial memory (preference for target quadrant in probe trials)

Potential explanations to investigate:

  • Compensatory mechanisms:

    • Evaluate whether other tetraspanins (especially the highly homologous Tspan7) show upregulation in Tspan6 KO mice

    • Examine alternative LTP mechanisms that might compensate for the observed deficit

    • Investigate potential homeostatic plasticity mechanisms

  • Circuit-specific effects:

    • Perform region-specific and cell-type-specific manipulations of Tspan6 expression

    • Examine effects on different hippocampal circuits (CA3-CA1, DG-CA3, etc.)

    • Investigate effects on inhibitory circuit function, which might compensate for excitatory changes

  • Methodological considerations:

    • Employ more sensitive behavioral assays (e.g., contextual fear conditioning, novel object recognition)

    • Test animals under challenging conditions that might reveal subtle deficits

    • Examine age-dependent effects, as compensatory mechanisms might diminish with aging

  • Molecular dissociation:

    • Investigate whether the mechanisms underlying LTP impairment are dissociable from those required for memory formation

    • Examine whether the enhanced basal transmission might offset the LTP deficit for memory formation

    • Study AMPA receptor trafficking and synaptic incorporation in more detail, as no changes in GluA1 surface expression were observed despite altered transmission

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.