Recombinant Mouse Thioredoxin-related transmembrane protein 4 (Tmx4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its inclusion.
Synonyms
Tmx4; D2Bwg1356e; Kiaa1162; Txndc13; Thioredoxin-related transmembrane protein 4; Thioredoxin domain-containing protein 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-335
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmx4
Target Protein Sequence
EGLEQAALPAEESRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWETFAKNGETL QISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIYEDLQNYILEKKWQSVE PLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFMG LILVVISECFCVPLPRASSERCEQEQSTGEAQGAEQLQDAEEEKDDSNEEENKDSLVDDE EEKEDIGDEDEGEEDEEEDNLAGIMAEERSDTNERAVVKEGSVSPKEDGAHPADTQDVVE DALRQRKSQNANKGS
Uniprot No.

Target Background

Database Links
Subcellular Location
Nucleus inner membrane; Single-pass type I membrane protein.

Q&A

What is TMX4 and what are its structural characteristics?

Thioredoxin-related transmembrane protein 4 (TMX4) is a member of the protein disulfide isomerase (PDI) family located primarily in the endoplasmic reticulum (ER). It is a type I transmembrane protein with an ER-targeting signal sequence, one thioredoxin-like (Trx-like) domain containing a catalytic CXXC motif, and one transmembrane domain . Specifically, TMX4 has a non-canonical cysteine-proline-serine-cysteine (CPSC) active site sequence . The proline residue at position 2 destabilizes the disulfide state, which favors the di-thiol reduced form of the active site .

Structurally, TMX4 consists of:

  • N-terminal ER-targeting signal sequence

  • Trx-like domain facing the ER lumen

  • Single transmembrane domain

  • C-terminal cytosolic region

A maleimide alkylation assay has shown that the catalytic CPSC motif in the TMX4 Trx-like domain undergoes changes in its redox state depending on cellular redox conditions, with most endogenous TMX4 existing in the oxidized form under normal cellular conditions .

Where is TMX4 localized within cells and how does this relate to its function?

TMX4 has been demonstrated to have a unique subcellular distribution pattern compared to other PDI family members. While primarily localized to the ER as a transmembrane protein, TMX4 shows a peculiar enrichment in the nuclear envelope (NE) . This differential localization suggests TMX4 may have specialized functions in these compartments.

Standard immunofluorescence techniques using antibodies against TMX4 and markers for the ER (such as PDI) show co-localization in the ER, but with distinct enrichment at the nuclear envelope . This localization pattern distinguishes TMX4 from other TMX family members like TMX3, which is more evenly distributed throughout the ER .

The enrichment of TMX4 at the nuclear envelope correlates with its interaction with NESPRIN proteins (nuclear envelope spectrin-repeat proteins), suggesting a role in maintaining or regulating nuclear envelope architecture through redox-dependent mechanisms .

What enzymatic activities does TMX4 possess and how can they be measured?

TMX4 primarily functions as a reductase in the ER environment. Its enzymatic properties include:

  • Reductase Activity: The redox potential of TMX4's Trx-like domain (-171.5 mV at 30°C, pH 7.0) indicates it can function as a reductase in the ER environment . This activity can be measured using:

    • Insulin reduction assay

    • Di-eosin-GSSG assay

    • Measurement of free thiols using DTNB (Ellman's reagent)

  • Redox Equilibrium Measurement: The redox equilibrium between recombinant TMX4-Trx and glutathione can be measured by incubating 1 μM TMX4-Trx with 0.1 mM GSSG and various concentrations of GSH at 30°C for 1 hour in 0.1 M sodium phosphate buffer (pH 7.0) containing 1 mM EDTA and 1 mM NDSB-201 with ultracentrifugation .

For accurate activity assessment, researchers should express and purify the recombinant Trx-like domain of TMX4 (typically amino acids 35-185) using bacterial expression systems with appropriate tags for purification .

How does TMX4 compare to other members of the TMX/PDI family?

TMX4 is one of four TMX family proteins (TMX1-TMX4) identified in the ER of mammalian cells. All four possess an ER-targeting signal sequence, one Trx-like domain with a catalytic CXXC motif, and one transmembrane domain, but they differ in several important aspects:

FeatureTMX1TMX2TMX3TMX4
Catalytic motifCXXCSNDC (non-canonical)CXXCCPSC (non-canonical)
Redox activityOxidoreductaseThought to be redox-inactiveIsomeraseReductase
Additional domainsNoneNoneb and b' domainsNone
Primary substratesMHC class I heavy chainUnknownUnknownNESPRIN proteins, integrin αIIbβ3
Subcellular enrichmentGeneral ERGeneral ERGeneral ERER with NE enrichment

Unlike TMX3, which contains additional b and b' domains similar to PDI and is suggested to have isomerase activity, TMX4 contains only a single Trx-like domain with reductase activity . TMX2 has an unusual catalytic motif (SNDC instead of CXXC) and is thought to be redox-inactive . TMX1 has oxidoreductase activity and prevents overexpressed major histocompatibility complex class I heavy chain from being degraded .

What experimental approaches can be used to study TMX4's protein interactions?

Several experimental approaches can be employed to study TMX4's protein interactions:

  • Co-immunoprecipitation (Co-IP): This technique has successfully demonstrated TMX4's interactions with calnexin and ERp57 . For Co-IP:

    • Use anti-TMX4 antibodies to pull down protein complexes

    • Alternatively, use tagged versions of TMX4 (HA-tag, V5-tag) for immunoprecipitation

    • Analyze precipitated proteins by Western blot or mass spectrometry

  • Mixed Disulfide Trapping Assay: This approach is particularly useful for identifying redox partners of TMX4:

    • Create a TMX4 C67A trapping mutant by replacing the second cysteine in the CPSC motif with alanine

    • Express this mutant in cells alongside potential interacting partners

    • Perform non-reducing SDS-PAGE to identify mixed disulfide species

    • Confirm with reducing conditions to dissociate the complexes

  • Mass Spectrometry-Based Approaches:

    • Express TMX4 C67A trapping mutant in cells

    • Immunoisolate complexes and analyze by mass spectrometry

    • Compare with other PDI family trapping mutants (TMX3 C56A, TMX5) to identify TMX4-specific clients

Using these methods, research has identified NESPRIN proteins (NESPRIN1 and NESPRIN2) as major clients of TMX4 but not of other TMX family members .

How can recombinant TMX4 be expressed and purified for functional studies?

For effective expression and purification of recombinant TMX4 for functional studies:

  • Expression Construct Design:

    • For full-length TMX4: Clone human or mouse TMX4 cDNA into an appropriate expression vector (e.g., pCDNA3.1(+) for mammalian expression)

    • For the Trx-like domain: Subclone the Trx-like domain region (amino acids 35-185) into a bacterial expression vector like pCold-TF, which incorporates a His6 tag and trigger factor (TF) at the N-terminus

    • Consider adding epitope tags (HA, V5) for detection and purification

  • Expression Systems:

    • Bacterial expression (E. coli): Suitable for the Trx-like domain alone

    • Mammalian expression (HEK293, mammalian cells): Better for full-length protein or when post-translational modifications are important

  • Purification Strategies:

    • Affinity chromatography using His-tag, DDK-tag, Myc-tag, Avi-tag, or Fc-tag depending on the construct design

    • Size exclusion chromatography for further purification

    • Ion exchange chromatography as needed

  • Activity Verification:

    • Assess reductase activity using insulin reduction assay

    • Verify redox potential through equilibrium with glutathione

    • Confirm proper folding using circular dichroism

For critical experiments, it's advisable to use both commercially available recombinant TMX4 proteins and laboratory-produced proteins to validate consistency in experimental results .

What is the role of TMX4 in platelet activation and thrombosis?

TMX4 plays a significant role in platelet activation and thrombosis, as demonstrated by studies using TMX4-deficient mice:

  • Functional Impact on Platelets:

    • TMX4 deficiency inhibits platelet aggregation

    • TMX4 deficiency reduces integrin αIIbβ3 activation

    • TMX4 deficiency decreases P-selectin expression and phosphatidylserine exposure

    • TMX4 deficiency diminishes thrombin generation

  • Thrombosis Models:

    • Tie2-Cre/TMX4 fl/fl mice (deficient in hematopoietic and endothelial TMX4) exhibit prolonged tail bleeding times and reduced platelet thrombus formation

    • Pf4-Cre/TMX4 fl/fl mice (deficient in platelet TMX4) show similar phenotypes

    • These phenotypes can be rescued by injection of recombinant TMX4 protein

  • Molecular Mechanism:

    • TMX4 appears to regulate the redox state of integrin αIIbβ3

    • Recombinant TMX4 protein reduces integrin αIIbβ3 disulfide bonds

    • TMX4 deficiency decreases free thiols of integrin αIIbβ3

    • These findings are consistent with TMX4's reductase activity

  • Therapeutic Implications:

    • Inactive TMX4 protein and specific anti-TMX4 antibodies inhibit platelet aggregation

    • This suggests potential for TMX4 targeting in antithrombotic strategies

These findings identify TMX4 as a novel PDI family member that enhances platelet activation and thrombosis, potentially through reduction of critical disulfide bonds in platelet proteins, particularly integrin αIIbβ3.

What experimental designs are appropriate for studying TMX4 function in vivo?

For studying TMX4 function in vivo, researchers can employ several experimental designs:

  • Genetic Approaches:

    • Conditional knockout models using tissue-specific Cre recombinase (e.g., Tie2-Cre for hematopoietic/endothelial cells, Pf4-Cre for platelets)

    • CRISPR/Cas9-mediated genome editing to introduce specific mutations (e.g., in the CPSC active site)

    • Transgenic overexpression models with wild-type or mutant TMX4

  • Thrombosis Models:

    • Tail bleeding time assay for hemostasis assessment

    • Laser-induced arterial injury model for real-time observation of thrombus formation

    • FeCl3-induced arterial injury model for stable thrombus formation

  • Rescue Experiments:

    • Administration of recombinant TMX4 protein to TMX4-deficient mice

    • Expression of wild-type or mutant TMX4 in TMX4-null cells

    • Use of tissue-specific inducible systems to control timing of TMX4 expression/deletion

  • Experimental Design Considerations:

    • Include proper controls (littermate controls, vehicle controls)

    • Utilize randomization and blinding where appropriate

    • Apply quasi-experimental designs when complete randomization is not possible

    • Consider factorial designs to study interactions between TMX4 and other factors

  • Measurement Approaches:

    • Immunohistochemistry for tissue localization

    • Intravital microscopy for real-time thrombus formation

    • Flow cytometry for platelet activation markers

    • Functional assays specific to the system being studied

When designing these experiments, researchers should consider the principles outlined in experimental design literature, including proper control groups, randomization, and statistical power calculations .

How can TMX4's role in redox-driven modulation of LINC-complexes be experimentally assessed?

TMX4's role in redox-driven modulation of Linker of Nucleoskeleton and Cytoskeleton (LINC) complexes represents an advanced research area. To experimentally assess this function:

  • Mixed Disulfide Trapping Approaches:

    • Express TMX4 C67A trapping mutant to stabilize TMX4-client mixed disulfides

    • Isolate complexes and identify NESPRIN partners using mass spectrometry or immunoblotting

    • Map specific cysteine residues involved in the interaction through site-directed mutagenesis of candidate cysteines in NESPRIN proteins

  • Redox State Analysis of NESPRIN Proteins:

    • Use maleimide-PEG labeling to quantify free thiols in NESPRIN proteins

    • Compare the redox state of NESPRINs in wild-type vs. TMX4-deficient cells

    • Employ diagonal redox 2D gel electrophoresis to identify disulfide-linked NESPRIN complexes

  • Functional Assessment of LINC Complex Dynamics:

    • Analyze nuclear envelope morphology in TMX4-deficient cells using electron microscopy

    • Perform fluorescence recovery after photobleaching (FRAP) of fluorescently-tagged NESPRIN proteins to assess mobility

    • Use proximity ligation assays to quantify interactions between NESPRIN and SUN proteins in the presence/absence of TMX4

  • Mechanistic Studies Under Stress Conditions:

    • Induce ER stress with thapsigargin, tunicamycin, or DTT treatment

    • Monitor changes in NESPRIN-SUN interactions and nuclear envelope morphology

    • Determine if TMX4 activity is required for recovery from ER stress-induced nuclear envelope alterations

  • Advanced Imaging Approaches:

    • Implement super-resolution microscopy to visualize TMX4-dependent changes in LINC complex organization

    • Use live-cell imaging with redox-sensitive fluorescent proteins fused to NESPRIN domains

    • Apply correlative light and electron microscopy to connect molecular events with ultrastructural changes

These experimental approaches should be designed with appropriate controls to distinguish TMX4-specific effects from general redox perturbations .

What methodological challenges exist in studying TMX4's contribution to asymmetric autophagy of the nuclear envelope?

Studying TMX4's contribution to asymmetric autophagy of the nuclear envelope presents several methodological challenges:

  • Distinguishing Nuclear Envelope Autophagy from General ER-phagy:

    • Challenge: The outer nuclear membrane (ONM) is continuous with the ER, making it difficult to distinguish ONM-specific autophagy

    • Solution: Develop ONM-specific markers and compare their degradation kinetics with general ER markers

    • Methodology: Use fluorescently-tagged ONM-specific proteins and monitor their turnover by live-cell imaging or pulse-chase experiments

  • Visualizing Asymmetric Autophagy Events:

    • Challenge: Asymmetric autophagy of the ONM while preserving the inner nuclear membrane (INM) requires specialized imaging approaches

    • Solution: Implement high-resolution microscopy techniques

    • Methodology: Use correlative light and electron microscopy (CLEM), focused ion beam scanning electron microscopy (FIB-SEM), or expansion microscopy to visualize asymmetric autophagy events

  • Establishing TMX4's Specific Role:

    • Challenge: Determining whether TMX4's role is direct or indirect

    • Solution: Create separation-of-function mutants and conduct rescue experiments

    • Methodology: Generate TMX4 variants with mutations in the CPSC active site or in regions mediating protein-protein interactions, then test their ability to restore normal nuclear envelope dynamics in TMX4-deficient cells

  • Temporal Resolution of Sequential Events:

    • Challenge: Determining the sequence of TMX4-mediated redox events and autophagy induction

    • Solution: Develop tools for temporal control and real-time monitoring

    • Methodology: Use optogenetic approaches to activate or inactivate TMX4 function with precise timing, combined with live-cell imaging of autophagy markers

  • Experimental Design Considerations:

    • Implement time-series experimental designs to capture dynamic processes

    • Use equivalent time-samples design when continuous monitoring is not possible

    • Consider multiple time-series design with appropriate controls to strengthen causal inferences

Addressing these challenges requires integration of advanced imaging, biochemical, and genetic approaches, often in combination with quasi-experimental designs that can accommodate the complexity of cellular systems .

How can contradictory data on TMX4 function be reconciled through experimental design?

Reconciling contradictory data on TMX4 function requires carefully designed experiments that address potential sources of variation and confounding factors:

  • Standardization of Experimental Systems:

    • Define standardized experimental conditions (cell types, expression levels, assay conditions)

    • Establish a common set of positive and negative controls

    • Create a shared repository of validated reagents (antibodies, recombinant proteins, expression constructs)

  • Factorial Experimental Design Approach:

    • Implement full factorial designs to systematically explore interactions between TMX4 and other factors

    • Include multiple levels of each factor to identify non-linear relationships

    • Use this approach to identify context-dependent effects that may explain contradictory results

    Example factorial design for studying TMX4 function:

    FactorLevels
    Cell typeFibroblasts, HepG2, Platelets
    Redox environmentOxidizing, Normal, Reducing
    TMX4 expressionKnockout, Endogenous, Overexpression
    ER stressNone, Thapsigargin, Tunicamycin, DTT
  • Multi-Method Validation:

    • Apply different methodological approaches to the same research question

    • For example, assess TMX4-NESPRIN interactions using co-IP, proximity ligation, FRET, and mixed disulfide trapping

    • Triangulate findings to identify robust, method-independent results

  • Reconciliation through Regression-Discontinuity Analysis:

    • When faced with contradictory threshold effects, apply regression-discontinuity analysis

    • This approach can help identify whether apparent contradictions result from threshold effects or experimental artifacts

  • Sequential Refinement Approach:

    • Begin with broad exploratory studies to identify potential factors influencing TMX4 function

    • Progressively refine experimental conditions based on initial findings

    • Develop increasingly targeted hypotheses to resolve specific contradictions

  • Meta-Analysis of Experimental Data:

    • Systematically compile and analyze results from multiple studies

    • Use statistical methods to identify sources of heterogeneity

    • Develop integrative models that can accommodate seemingly contradictory observations

By applying these approaches, researchers can distinguish genuine biological complexity from technical artifacts and develop more comprehensive models of TMX4 function that reconcile apparently contradictory data.

What advanced imaging techniques can be applied to study TMX4 localization and dynamics at the subcellular level?

Advanced imaging techniques provide powerful tools for studying TMX4 localization and dynamics at the subcellular level:

  • Super-Resolution Microscopy Approaches:

    • Stimulated Emission Depletion (STED) Microscopy: Achieves resolution of ~30-80 nm, enabling detailed visualization of TMX4 distribution within the ER and nuclear envelope

    • Photoactivated Localization Microscopy (PALM)/Stochastic Optical Reconstruction Microscopy (STORM): Offers ~10-20 nm resolution for precise mapping of TMX4 relative to other proteins

    • Structured Illumination Microscopy (SIM): Provides ~100 nm resolution with lower phototoxicity, suitable for live-cell imaging of TMX4 dynamics

  • Live-Cell Imaging for Dynamic Analysis:

    • Fluorescence Recovery After Photobleaching (FRAP): Measures mobility of fluorescently-tagged TMX4 within membranes

    • Fluorescence Loss in Photobleaching (FLIP): Assesses continuity of TMX4-containing compartments

    • Single-Particle Tracking (SPT): Follows individual TMX4 molecules to reveal heterogeneous behaviors

  • Correlative Light and Electron Microscopy (CLEM):

    • Combines fluorescence imaging of TMX4 with electron microscopy of the same sample

    • Provides ultrastructural context for TMX4 localization

    • Can be enhanced with immunogold labeling for TMX4 detection at the electron microscopy level

  • Proximity-Based Labeling Techniques:

    • Enzyme-Mediated Activation of Radical Sources (EMARS): Maps proteins in proximity to TMX4 in living cells

    • Proximity Ligation Assay (PLA): Detects TMX4 interactions with partner proteins with high sensitivity

    • BioID/TurboID: Identifies the proximal proteome of TMX4 through biotinylation

  • Redox-Sensitive Imaging Approaches:

    • Redox-Sensitive Fluorescent Proteins: Fusion of redox-sensitive GFP variants to TMX4 to monitor its redox state in real-time

    • Förster Resonance Energy Transfer (FRET): Detection of conformational changes in TMX4 upon redox transitions

    • Maleimide-Based Labeling: Visualization of TMX4 redox state through selective labeling of free thiols

Implementation considerations:

  • Use photobleaching controls to account for fluorophore stability

  • Include appropriate calibration standards for quantitative analyses

  • Validate findings across multiple imaging modalities

  • Consider potential artifacts introduced by protein tagging

These advanced imaging techniques, when properly implemented and controlled, can provide unprecedented insights into TMX4's spatial organization, dynamics, and functional interactions within the complex environment of the ER and nuclear envelope.

What experimental approaches would be suitable for investigating TMX4's potential role in disease pathogenesis?

Investigating TMX4's potential role in disease pathogenesis requires multifaceted experimental approaches that span from molecular mechanisms to clinical relevance:

  • Disease-Relevant Cell and Animal Models:

    • Develop disease-specific cell models:

      • Patient-derived primary cells

      • iPSC-derived disease-relevant cell types

      • CRISPR-engineered cells with disease-associated mutations

    • Create and characterize animal models:

      • Conditional TMX4 knockout in disease-relevant tissues

      • Knock-in models with disease-associated TMX4 variants

      • Double knockout models combining TMX4 deficiency with disease-predisposing factors

  • High-Throughput Screening Approaches:

    • CRISPR screens to identify genetic modifiers of TMX4 function

    • Small molecule screening to identify compounds that modulate TMX4 activity

    • Phenotypic screens in disease models with TMX4 modulation

  • Patient Sample Analysis:

    • Assess TMX4 expression and localization in patient tissues

    • Analyze TMX4 variants and their association with disease phenotypes

    • Examine the redox state of TMX4 substrates in patient samples

    Analysis TypeTechniqueInformation Gained
    ExpressionImmunohistochemistry, Western blot, qPCRTMX4 levels in disease contexts
    GeneticTargeted sequencing, WES/WGSDisease-associated variants
    FunctionalActivity assays, substrate redox stateAlterations in TMX4 function
    InteractionCo-IP, PLAChanges in protein partnerships
  • Disease-Specific Functional Assays:

    • For thrombotic disorders:

      • Ex vivo platelet aggregation studies with TMX4 modulation

      • Microfluidic thrombosis models using patient blood samples

      • Analysis of bleeding/clotting parameters in TMX4-deficient models

    • For ER stress-related diseases:

      • Unfolded protein response activation assessment

      • ER-associated degradation efficiency

      • Protein folding and secretion kinetics

  • Translational Research Approaches:

    • Develop TMX4-targeted therapeutic strategies (inhibitors, activators)

    • Identify biomarkers of TMX4 activity for patient stratification

    • Test combination approaches targeting TMX4 and disease-relevant pathways

  • Experimental Design Considerations:

    • Implement quasi-experimental designs when randomization is not feasible

    • Use multiple time-series designs to capture disease progression

    • Apply regression-discontinuity analysis for threshold effects

These approaches should be implemented with rigorous attention to experimental design principles, including appropriate controls, sample size calculations, randomization where possible, and blinding of outcome assessments to strengthen causal inferences about TMX4's role in disease.

How can response surface methodology be applied to optimize experimental conditions for studying TMX4 enzymatic activity?

Response Surface Methodology (RSM) provides a powerful approach for optimizing experimental conditions to study TMX4 enzymatic activity with maximum sensitivity and reliability:

  • Initial Screening Phase:

    • Identify factors potentially affecting TMX4 enzymatic activity:

      • pH (range 6.0-8.0)

      • Temperature (4-40°C)

      • Buffer composition (phosphate, HEPES, Tris)

      • Ionic strength (0-500 mM NaCl)

      • Reducing agent concentration (0-10 mM DTT/GSH)

      • TMX4 concentration (10 nM-1 μM)

      • Substrate concentration

    • Use fractional factorial designs to efficiently screen these factors with minimal experiments

    • Identify the most significant factors affecting TMX4 activity

  • Central Composite Design (CCD) for Optimization:

    • Based on screening results, select 3-5 most influential factors

    • Implement a central composite design with these factors

    • Example design for optimizing TMX4 reductase activity:

    FactorLow (-1)Center (0)High (+1)
    pH6.57.07.5
    Temperature (°C)253035
    GSH concentration (mM)0.52.03.5
    GSSG concentration (mM)0.050.10.15
    TMX4 concentration (μM)0.51.01.5
  • Regression Modeling and Analysis:

    • Fit second-order polynomial models to the experimental data

    • Example model: Activity = β₀ + β₁(pH) + β₂(Temp) + β₃(GSH) + β₄(GSSG) + β₅(TMX4) + β₁₂(pH×Temp) + β₁₃(pH×GSH) + ... + β₁₁(pH²) + β₂₂(Temp²) + ...

    • Analyze regression coefficients to understand main effects and interactions

    • Use contour plots and response surface plots to visualize relationships

  • Validation and Refinement:

    • Perform confirmatory experiments at predicted optimal conditions

    • If necessary, conduct sequential refinement by exploring narrower ranges around optimum

    • Apply ridge analysis if the optimum falls outside the experimental region

  • Special Considerations for TMX4:

    • Account for TMX4's redox potential (-171.5 mV at 30°C, pH 7.0)

    • Consider the non-canonical CPSC active site and its unique redox properties

    • Include controls with active site mutants (C64S or C67S) to confirm enzymatic specificity

    • Monitor potential oxidative inactivation during extended experiments

  • Software Implementation:

    • Use statistical software packages with RSM capabilities (R with rsm package)

    • Implement proper randomization and blocking to control for extraneous variables

    • Apply appropriate transformations if response variable shows non-normality or heteroscedasticity

What are the most effective strategies for quantitative analysis of TMX4-dependent changes in cellular redox homeostasis?

Quantitative analysis of TMX4-dependent changes in cellular redox homeostasis requires sophisticated experimental strategies that combine redox-specific probes, imaging techniques, and biochemical approaches:

These strategies provide complementary information about TMX4's impact on cellular redox homeostasis, from specific protein substrates to global redox environments, allowing researchers to develop comprehensive models of TMX4 function in health and disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.