Recombinant Mouse Threonylcarbamoyladenosine tRNA methylthiotransferase (Cdkal1)

Shipped with Ice Packs
In Stock

Description

Introduction

Cdk5 Regulatory Subunit Associated Protein 1 Like 1 (CDKAL1) is a protein associated with type 2 diabetes and is expressed in human islets and pancreatic insulinoma cells . It functions as a methylthiotransferase that modifies tRNA(Lys), improving the translational fidelity of transcripts, including the one encoding proinsulin . Genome-wide association studies have identified CDKAL1 as a susceptibility gene for type 2 diabetes, relating to reduced β-cell function and insulin release .

Molecular Function and Structure

CDKAL1 belongs to the e-MtaB subfamily of methylthiotransferases . It is a post-transcriptional tRNA modification enzyme that adds a methylthio (ms2-) moiety to the 2-position of N6-threonylcarbamoyladenosine-37 (t6A37) in tRNA Lys3 . The resulting ms2t6A37, located adjacent to the anticodon, enhances the translational fidelity for the tRNA to bind the lysine codons AAA/G on the ribosome . Only fully modified tRNA Lys3 can accurately and efficiently decode the AAA and AAG codons .

CDKAL1 is a tail-anchored protein in the endoplasmic reticulum (ER) of insulinoma cells . It depends on the TCR40/Get3-assisted pathway for the insertion of its C-terminal transmembrane domain into the endoplasmic reticulum .

Expression and Isoforms

Of the approximately five CDKAL isoforms, only CDKAL1 is expressed in human islets and pancreatic cells in culture . The cdkal1 gene is also critical to Drosophila melanogaster . In humans, single nucleotide polymorphisms (SNPs) within intron-5 of the human cdkal1 gene on human chromosome 6 are considered a high risk for type 2 diabetes .

Role in Insulin Production

CDKAL1 plays a vital role in insulin production. Silencing CDKAL1 in INS-1 cells reduces the expression of secretory granule proteins prochromogranin A and proICA512/ICA512-TMF, in addition to proinsulin and insulin, which correlates with reduced glucose-stimulated insulin secretion . Diminished function of Cdkal1 by knockdown of the cdkal1 gene in mouse NIT-1 cells results in a reduction of tRNA Lys3 modification, as well as a decrease in insulin mRNA and mature insulin .

Association with Type 2 Diabetes Mellitus (T2DM)

Homozygous recessive mutations in the human cdkal1 gene, such as SNPs in intron-5, are a significant risk factor for T2DM . A cdkal1-deficient mouse presents properties characteristic of human T2DM . SNPs in intron-5 of cdkal1 can cause alternative mRNA splicing and a reduction of Cdkal1 protein synthesis .

Meta-analysis of genetic variations, including homozygous recessive mutations in Cdkal1, shows that the occurrence of single nucleotide polymorphisms in the introns of Cdkal1 affects pre-mRNA processing events, impacting the production, processing, and availability of human insulin .

Dietary Interactions and Genetic Variants

Dietary protein and fat intake can affect diabetes risk in conjunction with CDKAL1 genetic variants . Several SNPs in the CDKAL1 gene are associated with fasting blood glucose and glycated hemoglobin levels . For example, SNPs rs7756992, rs9368222, rs2206734, rs9465871, rs7747752, and rs9356744 are significantly associated with fasting blood glucose and HbA1c .

SNPAssociation with Diabetes Risk
rs7756992Decreased
rs9368222Increased
rs2206734Increased
rs9465871Decreased
rs7747752Decreased
rs9356744Significant association
rs6908425Not significantly associated

Role of tRNA Lys3 in Insulin Production

In β-cells, Cdkal1 uniquely modifies tRNA Lys3 . The AAG codon in human pre-proinsulin mRNA codes for both Lys53 and Lys88. Lys88 is positioned adjacent to Arg89, which establishes the point at which a crucial protease cleavage separates the insulin A-chain from the C-peptide . In cdkal1-associated T2DM, a non-functioning or missing Cdkal1 protein in islet β-cells would result in tRNA Lys3 lacking the modification ms2t6A37. As a result, the tRNA Lys3 would not be able to insert lysine at position 88 in response to the AAG codon, and proinsulin would not be cleaved into insulin .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Cdkal1; Threonylcarbamoyladenosine tRNA methylthiotransferase; CDK5 regulatory subunit-associated protein 1-like 1; tRNA-t(6A37 methylthiotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-578
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cdkal1
Target Protein Sequence
MPSASCDVLLDDIEDIISQEDSKPQDRQFSRKHVFPKVRRRNTQKYLQEEPRPPSDSTIP GIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRN SIKKAQEENKKVVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQ KKDNGKRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVER AKQSFQEGVCEIWLTSEDTGAYGRDIGTDLPTLLWKLVEVIPEGAMLRLGMTNPPYILEH LEEMAKILNHPRVYAFLHIPVQSASDSVLMDMKREYCVADFKRVVDFLKEKVPGITIATD IICGFPGETDQDFQETVKLVEEYKFPSLFINQFYPRPGTPAAKAEQVPAHVKKQRTKDLS RVFHSYNPYDHKIGERQQVLVTEESFDSKFYVAHNRFYEQVLVPKNPAFMGKMVEVDIYE SGKHFLKGQPVSETRVYTPSISKPLAKGEVSGLTKEFRNRLGNHPNGTSDTCPATQHGSA YSRMVLQMSQYDCALKVATGLALLALLLHFWPDSLLTM
Uniprot No.

Target Background

Function

Recombinant Mouse Threonylcarbamoyladenosine tRNA methylthiotransferase (Cdkal1) catalyzes the methylthiolation of N6-threonylcarbamoyladenosine (t6A), producing 2-methylthio-N6-threonylcarbamoyladenosine (ms2t6A) at position 37 in tRNAs that recognize codons starting with adenine.

Gene References Into Functions
  1. Cdkal1 is crucial for maintaining normal mitochondrial morphology and function in adipose tissue, suggesting a role in regulating mitochondrial activity in type 2 diabetes. PMID: 29031721
  2. CDKAL1 may influence compensatory mechanisms regulating glucose homeostasis through dietary interactions. PMID: 23173044
  3. Pancreatic beta-cell-specific Cdkal1 knockout mice exhibit pancreatic islet hypertrophy and impaired glucose control. PMID: 21908934
  4. Cdkal1 is a mammalian methylthiotransferase synthesizing 2-methylthio-N6-threonylcarbamoyladenosine (ms2t6A) in tRNALys(UUU), essential for accurate AAA and AAG codon translation. PMID: 21841312
  5. CDKAL1 regulates first-phase insulin exocytosis in beta cells by influencing ATP generation, KATP channel responsiveness, and Ca2+ channel activity through mechanisms independent of CDK5 regulation. PMID: 21151568
Database Links
Protein Families
Methylthiotransferase family, CDKAL1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in pancreas, liver and skeletal muscle, especially in white muscle fibers.

Q&A

What is the molecular function of Cdkal1 and how was it discovered?

Cdkal1 (CDK5 regulatory subunit associated protein 1-like 1) is a mammalian methylthiotransferase that biosynthesizes 2-methylthio-N6-threonylcarbamoyladenosine (ms2t6A) in tRNA(Lys)(UUU). This modification is crucial for the accurate translation of AAA and AAG codons during protein synthesis. The gene was initially identified through genome-wide association studies (GWAS) as a type 2 diabetes susceptibility locus, with variants strongly linked to increased diabetes risk in a nearly recessive manner across diverse populations .

Cdkal1 shares protein domain architecture with its homolog CDK5RAP1 and bacterial methyl-thiol transferase (MTT) proteins. These enzymes utilize two [4Fe-4S] cluster cofactors, bound to an N-terminal MTT domain and a central radical S-adenosyl methionine (SAM) domain, to add a methylthiol moiety (-SCH₃) to a non-activated carbon on their substrates .

Cdkal1 expression exhibits tissue-specific regulation patterns. In pancreatic β-cells, Cdkal1 expression is glucose-responsive, with expression levels varying according to glucose concentration. Notably, reduced expression is observed under glucotoxic conditions compared to normal glucose concentrations, suggesting a potential mechanism by which hyperglycemia might further impair β-cell function .

In adipose tissue, Cdkal1 mRNA levels are reduced in obese mice compared to lean controls, indicating potential regulation by metabolic status . This suggests that Cdkal1 dysregulation may occur in multiple tissues during metabolic disease progression.

For experimental assessment of Cdkal1 expression regulation, researchers have cultured rat pancreatic β-cell line INS-1 in the presence of variable glucose concentrations (ranging from 2.5–30 mM) to evaluate glucose-dependent regulation .

What are the molecular mechanisms by which Cdkal1 deficiency contributes to type 2 diabetes?

The molecular pathways linking Cdkal1 deficiency to type 2 diabetes involve multiple mechanisms:

  • Impaired tRNA modification and translational fidelity: Cdkal1 deficiency leads to impaired ms2t6A modification of tRNA(Lys)(UUU), resulting in misreading of AAA and AAG lysine codons. In β-cells, this causes:

    • Misreading of lysine codons in proinsulin

    • Reduced glucose-stimulated proinsulin synthesis

    • Production of aberrant insulin proteins

  • ER stress pathway activation: Cdkal1 deficiency triggers:

    • Upregulation of ER stress-related genes

    • Structural abnormalities in the ER

    • Hypersensitivity to high-fat diet-induced ER stress

    • Altered expression of the ER stress marker CHOP10

  • Mitochondrial dysfunction: Studies in adipose-specific knockout models reveal:

    • Impaired mitochondrial respiration in brown adipocytes

    • Highly disrupted mitochondrial morphology

    • Altered expression of mitochondrial proteins like ANT1

These mechanisms act synergistically to impair β-cell function and insulin secretion, ultimately contributing to diabetes pathogenesis. Interestingly, the effects of Cdkal1 genetic variants are primarily observed in homozygous carriers, consistent with the nearly recessive mode of inheritance for type 2 diabetes risk .

How can researchers investigate the subcellular localization and membrane insertion of Cdkal1?

Cdkal1 has been identified as a tail-anchored protein inserted into the endoplasmic reticulum (ER) via the TRC40/Get3 pathway . To study its subcellular localization and membrane insertion, researchers can employ:

  • Subcellular fractionation: Separation of cellular components followed by Western blotting to detect Cdkal1 in different fractions.

  • Immunofluorescence microscopy: Co-staining with organelle markers to visualize Cdkal1 localization.

  • Membrane insertion assays: In vitro translation systems combined with microsomal membranes to study the mechanism of membrane insertion.

  • Domain mapping experiments: Construction of truncation mutants to identify the tail-anchor domain responsible for ER targeting.

  • Interaction studies with TRC40/Get3: Co-immunoprecipitation and mass spectrometry to confirm the role of this pathway in Cdkal1 membrane insertion.

When investigating membrane proteins like Cdkal1, it's critical to use appropriate detergents for extraction and to verify results with multiple complementary approaches to distinguish between peripheral and integral membrane association .

What experimental approaches can be used to study Cdkal1-mediated tRNA modifications?

Studying the tRNA methylthiotransferase activity of Cdkal1 requires specialized techniques:

  • HPLC-coupled mass spectrometry: For detection and quantification of ms2t6A-modified tRNAs, allowing measurement of the 2-methylthio-N6-threonylcarbamoyladenosine modification.

  • In vitro methylthiotransferase assays: Using purified recombinant Cdkal1 protein, tRNA(Lys) substrates, S-adenosylmethionine, and [Fe-S] cluster cofactors.

  • tRNA northern blotting: With probes specific for tRNA(Lys)(UUU) to assess levels of specific tRNA species.

  • APM-PAGE ([(N-acryloylamino)phenyl]mercuric chloride polyacrylamide gel electrophoresis): To separate thiolated from non-thiolated tRNAs based on the interaction between mercury and sulfur.

  • Codon-specific translation reporter systems: To measure translation efficiency of lysine codons (AAA/AAG) in the presence or absence of Cdkal1.

When designing these experiments, researchers should consider the oxygen sensitivity of [Fe-S] cluster-containing enzymes like Cdkal1 and perform reactions under anaerobic conditions when appropriate .

How does Cdkal1 function in adipose tissue and how does it impact mitochondrial activity?

Cdkal1 plays a previously unappreciated role in adipose tissue mitochondrial function, distinct from its known role in tRNA modification:

  • Adipose-specific functions: In adipose-specific Cdkal1 knockout (A-KO) mice:

    • Mitochondrial function is impaired in primary differentiated brown adipocytes

    • Energy expenditure is decreased during cold temperature challenge (4°C)

    • Mitochondrial morphology is highly abnormal in brown adipose tissue

  • Mitochondrial protein interactions: CDKAL1 interacts with novel protein partners in mitochondria, including:

    • SLC25A4/ANT1, an inner mitochondrial membrane ADP/ATP translocator

    • ANT proteins that can account for UCP1-independent basal proton leak in BAT mitochondria

  • Measurement approaches: Researchers can assess Cdkal1's impact on mitochondrial function using:

    • Cellular and isolated mitochondrial oxygen consumption rate (OCR) measurements

    • Electron microscopy to evaluate mitochondrial ultrastructure

    • Co-immunoprecipitation followed by mass spectrometry to identify mitochondrial binding partners

Interestingly, these mitochondrial effects appear to be independent of the canonical role of Cdkal1 in tRNA modification, as lysine codon representation was unchanged in Cdkal1 A-KO adipose tissue. This suggests Cdkal1 has additional functions beyond its characterized role as a tRNA modifier .

What are the genetic associations between Cdkal1 polymorphisms and type 2 diabetes risk?

Multiple Cdkal1 polymorphisms have been associated with type 2 diabetes risk across diverse populations:

SNPRisk AlleleAssociation with T2DMOdds Ratio (OR)Population EffectsReference
rs4712523GIncreased risk (allele model)OR = 1.172; 95% CI: 1.103–1.244Significant in East Asian subgroup
rs4712524GIncreased risk (multiple models)OR = 1.146–1.455 across modelsSignificant across populations
rs9460546GIncreased risk (allele model)OR = 1.215; 95% CI: 1.167–1.264Low heterogeneity among studies

The disease-associated SNPs fall within intronic regions of the 700 kb Cdkal1 locus, suggesting they may influence gene expression rather than protein structure. These variants are associated with impaired insulin secretion in non-diabetic subjects, indicating that β-cells may be particularly affected .

When investigating these genetic associations, researchers should consider:

  • Differences in effect sizes across populations

  • Potential gene-environment interactions

  • The nearly recessive inheritance pattern (homozygous carriers show a stronger effect)

  • Heterogeneity across studies due to differences in genetic background and environmental factors

How can researchers measure the impact of Cdkal1 on ER stress pathways?

Cdkal1 deficiency is associated with ER stress activation in β-cells. To investigate this relationship, researchers can employ:

  • RT-qPCR analysis of ER stress marker genes:

    • CHOP10 (DDIT3)

    • BiP (HSPA5)

    • XBP1 (including spliced XBP1)

    • ATF4 and ATF6

    • PERK (EIF2AK3)

    • IRE1α (ERN1)

  • Western blotting to measure protein levels and phosphorylation status of:

    • PERK and phospho-PERK

    • eIF2α and phospho-eIF2α

    • IRE1α and phospho-IRE1α

    • CHOP10

  • XBP1 splicing assay: PCR-based detection of spliced vs. unspliced XBP1 mRNA

  • Electron microscopy to assess ER morphology and structure

  • ER stress induction experiments: Treating cells with:

    • Thapsigargin (SERCA inhibitor)

    • Tunicamycin (N-glycosylation inhibitor)

    • High glucose conditions

    • Free fatty acids

  • TUNEL assay to measure ER stress-induced apoptosis

When studying Cdkal1's role in ER stress, it's important to consider the cross-talk between ER stress and other cellular stress pathways, including oxidative stress and mitochondrial dysfunction .

What experimental challenges exist in studying Cdkal1 biochemical activity?

Investigating Cdkal1's enzymatic activity presents several technical challenges:

  • [Fe-S] cluster sensitivity: As an iron-sulfur cluster-containing enzyme, Cdkal1:

    • Is sensitive to oxygen

    • Requires anaerobic conditions for in vitro activity assays

    • Needs reducing agents for stability

  • Substrate specificity determination: Identifying the precise tRNA substrates and modification sites requires:

    • Mass spectrometry analysis of modified nucleosides

    • In vitro transcription of specific tRNAs

    • Site-directed mutagenesis to confirm target residues

  • Recombinant protein expression: Obtaining active enzyme requires:

    • Expression systems capable of [Fe-S] cluster assembly

    • Co-expression with iron-sulfur cluster assembly machinery

    • Careful purification under reducing conditions

  • Activity assays: Measuring methylthiotransferase activity involves:

    • Radioactive assays with ³⁵S-labeled SAM

    • LC-MS/MS detection of modified nucleosides

    • Specialized HPLC methods for tRNA analysis

  • Structural characterization: Determining Cdkal1's structure is complicated by:

    • The presence of multiple domains

    • The labile nature of [Fe-S] clusters

    • Membrane association properties

Researchers must carefully design experimental conditions that preserve Cdkal1's enzymatic activity while allowing accurate measurement of its biochemical functions .

How can Cdkal1 research inform therapeutic approaches for type 2 diabetes?

Understanding Cdkal1 function provides several potential avenues for therapeutic development:

  • Targeting tRNA modification pathways: Enhancing or mimicking Cdkal1-mediated tRNA modifications could potentially improve translational fidelity in β-cells, particularly for carriers of Cdkal1 risk variants.

  • ER stress modulation: Since Cdkal1 deficiency leads to ER stress activation, compounds that reduce ER stress might be particularly beneficial for individuals with Cdkal1 risk variants.

  • Biomarker development: Cdkal1 genetic variants could be used as biomarkers to:

    • Stratify diabetes risk

    • Predict treatment response

    • Identify individuals who might benefit from early intervention

  • Mitochondrial function enhancement: Given Cdkal1's role in mitochondrial function in adipose tissue, targeting mitochondrial bioenergetics might represent a novel therapeutic approach.

  • Personalized medicine approaches: The strong genetic association between Cdkal1 variants and T2D suggests that treatment strategies might be tailored based on an individual's Cdkal1 genotype.

Research methodologies should focus on validating these potential therapeutic targets through:

  • High-throughput screening for compounds that enhance Cdkal1 activity or bypass its deficiency

  • Animal models with tissue-specific Cdkal1 ablation to test targeted interventions

  • Translational studies in human subjects stratified by Cdkal1 genotype

What approaches can be used to study the tissue-specific functions of Cdkal1?

Cdkal1 exhibits diverse functions across tissue types. To investigate these tissue-specific roles, researchers can employ:

  • Conditional knockout models:

    • Tissue-specific Cre-loxP systems (e.g., Ins1-Cre for β-cells, Adipoq-Cre for adipocytes)

    • Inducible systems (e.g., tamoxifen-inducible CreERT2) for temporal control

    • Viral delivery of Cre recombinase to specific tissues

  • Tissue-specific overexpression models:

    • Transgenic mice with tissue-specific promoters

    • AAV-mediated gene delivery to specific tissues

  • Ex vivo tissue culture systems:

    • Isolated pancreatic islets

    • Primary adipocyte cultures

    • Tissue explant cultures

  • Cell type-specific RNA-seq and proteomics:

    • Single-cell RNA sequencing to identify cell-specific effects

    • Tissue-specific ribosome profiling to assess translation

    • Laser capture microdissection coupled with molecular analysis

  • Tissue-specific phenotyping:

    • Glucose-stimulated insulin secretion for β-cells

    • Oxygen consumption for adipocytes

    • Metabolic cage studies for whole-body energy expenditure

    • Tissue-specific isotope tracing for metabolic flux analysis

When designing these studies, it's crucial to consider the interaction between different tissues in metabolic regulation and to assess whether Cdkal1 deficiency in one tissue might indirectly affect others through systemic factors .

How do environmental factors interact with Cdkal1 function and genetics?

Cdkal1 function appears to be modulated by environmental factors, providing important context for genetic studies:

  • Glucose modulation: Cdkal1 expression in pancreatic β-cells is regulated by glucose concentration, with reduced expression under glucotoxic conditions. This suggests a mechanism by which hyperglycemia might exacerbate genetic risk .

  • Diet interactions: β-cell Cdkal1 knockout mice are hypersensitive to high-fat diet-induced ER stress, indicating a gene-diet interaction .

  • Obesity effects: Cdkal1 mRNA levels are reduced in adipose tissue of obese mice, suggesting obesity may downregulate Cdkal1 expression .

Methodological approaches to study these interactions include:

  • Diet challenge studies in Cdkal1 knockout models

  • In vitro culture systems with varying nutrient conditions

  • Human studies correlating Cdkal1 genotype with diet and lifestyle factors

  • Epigenetic analysis to identify environmental influences on Cdkal1 expression

When investigating these interactions, researchers should consider:

  • The timing of environmental exposures

  • Potential tissue-specific responses

  • Epigenetic mechanisms that might mediate environmental effects

  • Interaction effects on both Cdkal1 expression and function

What is the significance of Cdkal1's evolutionary conservation and homology to other proteins?

Cdkal1 belongs to an evolutionarily conserved family of methylthiotransferases with important implications for research:

  • Evolutionary conservation: Cdkal1 shares domain architecture and 18-23% amino acid identity with bacterial methyl-thiol transferase (MTT) proteins including MiaB, MtaB, and RimO. This conservation suggests fundamental biological importance .

  • Homology to CDK5RAP1: Cdkal1's homolog CDK5RAP1 regulates mitochondrial protein translation and function in skeletal muscle. Comparative studies between these proteins can reveal shared and distinct functions .

  • Functional domains: Cdkal1 contains:

    • An N-terminal MTT domain

    • A central radical S-adenosyl methionine (SAM) domain

    • A C-terminal TRAM domain for substrate specificity

Research approaches leveraging this evolutionary perspective include:

  • Comparative analysis across species to identify conserved functional elements

  • Domain swapping experiments between Cdkal1 and related proteins

  • Identifying conserved binding partners and substrates

  • Using bacterial homologs for structural and mechanistic studies

  • Cross-species complementation experiments to test functional conservation

These evolutionary insights can guide the design of experiments to understand Cdkal1's fundamental biochemical functions and potentially identify additional roles beyond its characterized tRNA modification activity .

What methods are most effective for detecting and measuring Cdkal1 protein levels?

Accurate detection and quantification of Cdkal1 presents several technical challenges. The following approaches can be employed:

  • Western blotting:

    • Use fresh samples with protease inhibitors

    • Include reducing agents to maintain [Fe-S] cluster integrity

    • Consider membrane fractionation protocols for this tail-anchored protein

    • Validate antibodies carefully to ensure specificity

  • Immunoprecipitation followed by mass spectrometry:

    • Use appropriate detergents for membrane protein extraction

    • Consider crosslinking approaches for capturing transient interactions

    • Employ targeted mass spectrometry (MRM/PRM) for quantitative analysis

  • Immunofluorescence microscopy:

    • Optimize fixation methods to preserve ER structure

    • Use co-staining with organelle markers to confirm subcellular localization

    • Consider super-resolution techniques for detailed localization studies

  • ELISA-based quantification:

    • Develop sandwich ELISA with validated antibody pairs

    • Include recombinant protein standards for quantification

  • Flow cytometry:

    • For cell-by-cell analysis of Cdkal1 levels

    • Particularly useful for heterogeneous cell populations

When designing these experiments, researchers should be aware that Cdkal1's membrane association and iron-sulfur cluster content may affect extraction efficiency and detection sensitivity .

What are the key considerations for designing Cdkal1 knockout and knockdown experiments?

When designing loss-of-function studies for Cdkal1, researchers should consider:

  • Knockout strategies:

    • Complete gene deletion vs. conditional approaches

    • Targeting specific functional domains vs. whole gene

    • CRISPR/Cas9 design with minimal off-target effects

    • Verification of knockout at DNA, RNA, and protein levels

  • Knockdown approaches:

    • siRNA vs. shRNA for different duration of silencing

    • Dosage titration to achieve partial vs. complete knockdown

    • Use of inducible systems for temporal control

    • Multiple targeting sequences to confirm specificity

  • Controls and validation:

    • Include rescue experiments with wild-type Cdkal1

    • Use domain mutants to identify critical functional regions

    • Assess known downstream effects (e.g., tRNA modification, insulin processing)

    • Include appropriate scrambled or non-targeting controls

  • Phenotypic analysis:

    • For β-cell models: measure insulin content, proinsulin processing, glucose-stimulated insulin secretion

    • For adipocyte models: assess mitochondrial function, energy expenditure

    • Consider compensatory mechanisms and potential redundancy with related proteins

  • Timing considerations:

    • Acute vs. chronic Cdkal1 deficiency may have different effects

    • Developmental timing may be crucial for certain phenotypes

    • Consider inducible systems for adult-onset deletion

These considerations will help ensure robust and interpretable results when studying Cdkal1 function through loss-of-function approaches .

What are the best experimental systems for studying Cdkal1 in different contexts?

Selecting appropriate experimental systems is critical for investigating different aspects of Cdkal1 function:

Research FocusRecommended SystemsKey AdvantagesLimitations
β-cell function- MIN6, INS-1, EndoC-βH1 cell lines
- Primary isolated islets
- β-cell-specific knockout mice
- Physiological insulin secretion
- Glucose responsiveness
- In vivo relevance
- Islet isolation complexity
- Limited proliferation of primary cells
Adipose function- 3T3-L1 adipocytes
- Primary brown/white adipocytes
- Adipose-specific knockout mice
- Differentiation capacity
- Metabolic responsiveness
- Tissue-specific effects
- Variability in differentiation
- Differences from human adipocytes
tRNA modification- In vitro enzyme assays
- Bacterial expression systems
- Cell-free translation systems
- Biochemical precision
- Controlled conditions
- Direct measurement
- May lack cellular context
- Challenges with [Fe-S] clusters
Genetic associations- Human cohort studies
- GWAS data analysis
- iPSC-derived cells from genotyped donors
- Clinical relevance
- Population-level insights
- Human genetic background
- Complex multifactorial effects
- Limited mechanistic insight

When choosing between these systems, researchers should consider:

  • The specific research question being addressed

  • The need for physiological relevance vs. experimental control

  • Technical feasibility and available resources

  • The potential for translational relevance

Combining multiple complementary systems often provides the most comprehensive understanding of Cdkal1 function in different contexts .

How can researchers address discrepancies in Cdkal1 research findings?

Literature on Cdkal1 contains some apparent discrepancies that require careful methodological approaches to resolve:

  • Tissue-specific effects: Studies focusing solely on β-cells may miss important functions in other tissues like adipose. Comprehensive phenotyping across multiple tissues is essential .

  • Translation fidelity vs. other functions: While β-cell studies highlight translational fidelity issues, adipose tissue studies found unchanged lysine codon representation despite functional effects. This suggests context-dependent mechanisms requiring targeted investigation .

  • Mouse vs. human differences: Genetic associations in humans may not fully translate to mouse models. Consider:

    • Humanized mouse models

    • Direct studies in human tissues/cells

    • Comparison of human and mouse Cdkal1 function

  • Variant effects: Different Cdkal1 SNPs show variable associations across populations with heterogeneity in study results. Addressing this requires:

    • Meta-analyses with subgroup analysis by ethnicity

    • Functional studies of specific variants

    • Investigation of gene-environment interactions

  • Replication challenges: When results cannot be reproduced, consider:

    • Differences in experimental conditions

    • Genetic background variations

    • Environmental factors

    • Technical variations in assays

    • Statistical power and sample size

Researchers should address discrepancies through:

  • Direct replication studies with detailed methodological reporting

  • Head-to-head comparisons under identical conditions

  • Collaborative cross-laboratory validation

  • Development of standardized protocols for key Cdkal1 assays

This systematic approach can help resolve contradictions and build a more coherent understanding of Cdkal1 biology .

What emerging technologies could advance Cdkal1 research?

Several cutting-edge technologies hold promise for deepening our understanding of Cdkal1:

  • CRISPR base editing and prime editing: For introducing specific Cdkal1 variants without double-strand breaks, allowing precise modeling of human SNPs in cellular and animal models.

  • Single-cell multi-omics: Combining single-cell transcriptomics, proteomics, and metabolomics to understand cell-specific responses to Cdkal1 deficiency across tissues.

  • Cryo-EM structural analysis: To determine the three-dimensional structure of Cdkal1, particularly in complex with its tRNA substrate and cofactors.

  • Spatially resolved transcriptomics: To map Cdkal1 expression and downstream effects across tissue microenvironments.

  • Nanopore direct RNA sequencing: For direct detection of tRNA modifications without the need for specialized chemical treatments.

  • Organoid systems: For studying Cdkal1 function in more physiologically relevant 3D tissue models, particularly for pancreatic islets and adipose tissue.

  • In vivo CRISPR screens: To identify genetic modifiers of Cdkal1 function in relevant tissues.

  • Metabolic tracing with stable isotopes: To track how Cdkal1 deficiency affects specific metabolic pathways in different tissues.

These technologies can help address knowledge gaps regarding Cdkal1's structural properties, tissue-specific functions, and role in complex metabolic networks .

What are the unexplored aspects of Cdkal1 biology that warrant investigation?

Despite significant advances, several aspects of Cdkal1 biology remain poorly understood:

  • Non-canonical functions: Beyond tRNA modification, Cdkal1 may have additional roles that explain tissue-specific effects. These could include:

    • Direct protein interactions independent of translation

    • Potential roles in non-coding RNA regulation

    • Functions related to its ER localization

  • Developmental roles: The impact of Cdkal1 deficiency during embryonic and postnatal development remains largely unexplored, particularly in:

    • Pancreatic β-cell development and maturation

    • Adipose tissue development and remodeling

    • Potential roles in stem cell biology

  • Regulation of Cdkal1: Little is known about how Cdkal1 itself is regulated at the:

    • Transcriptional level

    • Post-transcriptional level

    • Post-translational level

    • Through subcellular localization

  • Additional substrates: Whether Cdkal1 modifies substrates beyond tRNA(Lys)(UUU) remains an open question.

  • Interaction with other tRNA modifiers: How Cdkal1 functions within the broader network of tRNA modification enzymes.

  • Species-specific functions: Comparative studies across species could reveal evolutionary adaptations in Cdkal1 function.

  • Role in other diseases: Beyond type 2 diabetes, Cdkal1 variants have been associated with other conditions that warrant deeper investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.